KEGG   Candidatus Pelagibacter ubique: SAR11_0430Help
Entry
SAR11_0430        CDS       T00257                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00010  Glycolysis / Gluconeogenesis
pub00020  Citrate cycle (TCA cycle)
pub00620  Pyruvate metabolism
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01130  Biosynthesis of antibiotics
pub01200  Carbon metabolism
Module
pub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_0430 (aceF)
   00020 Citrate cycle (TCA cycle)
    SAR11_0430 (aceF)
   00620 Pyruvate metabolism
    SAR11_0430 (aceF)
Enzymes [BR:pub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAR11_0430 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 PYNP_C GCV_H HlyD_D23 DUF106
Motif
Other DBs
NCBI-ProteinID: AAZ21252
UniProt: Q4FNI7
Position
419944..421215
Genome map
AA seq 423 aa AA seqDB search
MSDKEIKVPNIGEFKDVEVIEVLVSNGQSVSKNDPLITIESDKSSVEIPASFDGKIKSVK
IKVGDRVSEGDLILTIEQSGEEEKKIEQKTIKEAEQVTNQNQVEKIAKVNPAQNTIKKDN
SEISSASPKVRKFARELGVNINEIVGSERQGRIVEDDVKNFISSRINKAPDKTEVQPKKI
VSEYSHSDFGEIEVKDMPRVKKLASTYLVNSWTTIPHVTNHDEADITEMEDFRTSLTDMY
TGERKKITPLAFIVKALVASLKKFPSFNSSIDDIENGKITMKNYFHVGIAVDTPHGLMVP
KIRNADNKSISYISNELKIVSDQCRNLKIDKKEFFGGSMTITSLGGIGGSFFTPIINYPE
VAILGVGKAQKKQIFINGKFETRTMLPLSLSYDHRIIDGAEAARFNNDLKENLGKNFAYK
LAV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataaagagattaaagtaccaaatattggtgaatttaaagacgttgaggtaatt
gaggtgctagtttcaaatggccagtcagtttctaaaaatgatccacttattacaattgag
agtgacaaatctagtgttgaaataccagcttcttttgatggaaagattaagtctgttaaa
attaaagtgggagatagggtttcagaaggtgatttaatattaactatagaacagtctgga
gaagaagaaaaaaaaatagaacaaaaaactattaaagaagcagaacaagttacaaatcaa
aatcaagtagaaaaaattgcaaaagtcaatccagcacaaaatacaataaaaaaagataat
tcagaaatttcatctgcaagcccaaaagtacgtaaatttgctagagaacttggggttaat
attaatgaaatagttggtagtgaaagacagggaagaattgtggaagatgatgtaaaaaat
tttatatcctctagaattaataaagctccagataagaccgaagttcaaccaaaaaaaatt
gttagtgaatattctcattctgattttggtgaaattgaagttaaagatatgcctagagtt
aaaaaattagcctctacatatttagttaattcttggactacaatacctcatgtcacaaat
catgatgaagcagatataactgaaatggaagattttagaacttcacttactgacatgtat
acaggggaaagaaaaaaaattactccattagcttttattgttaaagctttagttgcatct
ttaaaaaagtttcctagtttcaactcttcaatagatgatattgaaaatggaaaaattaca
atgaaaaactattttcatgttgggattgcagtggatactccacatggtttaatggtgcca
aaaattagaaatgctgacaataaaagcatctcatatattagcaatgaattgaaaatagta
agtgaccaatgtagaaatttaaaaatagataagaaagaattttttggaggatctatgact
attacgagtcttggaggaattggaggttcattctttacaccaataataaattatccagaa
gttgctatattaggagtaggcaaggcacaaaaaaaacaaatttttattaatgggaaattt
gaaacaagaacaatgctaccgctttctttatcatatgatcacagaataattgatggagct
gaagcagctagatttaataatgatctaaaagaaaatttaggcaaaaattttgcttataaa
ttagctgtatag

DBGET integrated database retrieval system