KEGG   Candidatus Pelagibacter ubique: SAR11_0793
Entry
SAR11_0793        CDS       T00257                                 

Name
(GenBank) Unknown protein
Organism
pub  Candidatus Pelagibacter ubique
SSDB
Motif
Pfam: IAT_beta
Other DBs
NCBI-ProteinID: AAZ21611
UniProt: Q4FMH8
Position
766600..767475
AA seq 291 aa
MKFIKIFLTSLCLIITTVANADVASQALNKVSEKISNLIPGEGITEVSLDYNDGDEDQLN
FSILGVRDIETTDNSNFFTQFSLMNQEINSSGRIIGNIGLGYRKLSEDKNFMFGANTFYD
RDLTEGQDRLGLGIEAKGSILDLTANSYTKISNSEVVNGDREQVLSGWDFNLTSQIPRAP
WARINYNGYKWETEKGSADQKGNIYSLELDVTNSVEVVASLDKSSLNGVDDETSLSINYI
YPPKEKSMVMSDGLSNDMFEKSNMEQKLKEKVRRRNKLVMEIQGAVVMTKK
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaaatttataaaaatatttttaacatcactctgtttaataatcacaactgtagctaat
gcagatgtagcctctcaagctttaaataaagtatctgaaaaaatatcaaatttaatccca
ggtgaaggaattactgaagtatctttagattataatgatggtgatgaggatcagcttaac
ttctcaatattaggggtaagagatattgaaacaacagataactctaatttttttactcaa
tttagtttgatgaaccaggaaataaacagttccggaagaattattggaaacataggctta
ggttatagaaaactatctgaagataaaaattttatgtttggcgcaaatactttctacgat
agagatttaacagagggtcaagacagattaggccttggtattgaagctaaaggttcaatt
ttagatttaactgcaaatagctatacaaaaatttcaaactctgaagttgttaatggtgat
agagagcaagttttatctggttgggattttaacttaacatctcaaattccaagagcacca
tgggctagaattaattataatggttataaatgggaaactgaaaaaggatctgctgatcaa
aaaggtaatatttattctctagaactagatgtaacaaactcagtagaagttgttgcaagt
ttagacaaatcctcactaaatggtgtggatgatgaaacttctttaagtattaattatatt
tatccaccaaaagaaaaatctatggtgatgtctgacggtttatcaaatgacatgtttgaa
aaaagtaacatggaacaaaaattaaaagaaaaagttagaagaagaaataaactagtaatg
gaaattcagggagcagtcgtcatgactaaaaaataa

DBGET integrated database retrieval system