KEGG   Candidatus Pelagibacter ubique: SAR11_1240Help
Entry
SAR11_1240        CDS       T00257                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00630  Glyoxylate and dicarboxylate metabolism
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAR11_1240 (aceA)
Enzymes [BR:pub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SAR11_1240 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAZ22044
UniProt: Q4FL94
Position
complement(1182407..1183681)
Genome map
AA seq 424 aa AA seqDB search
MSAENISYDLKRFAGIKRDYTPEEVERLRGSFKIEYSMCKHQSKKLWDLLNSENYINTLG
SLSGNHAIQHAKAGLKAIYLSGWQVAADANTAGEMYPDQSLYPYDSAPKLVESMNNALIR
ADQIQHMELQDGEMKSNDRTDYMLPIIADGEAGFGGPLNVFELAKKFIKAGAAGVHFEDQ
LASEKKCGHMGGKVLVPTGTMIKNLKAARLAADIADVPLIILARTDANAAKLITNDFDEN
DKPFLTGERSPEGFYYVKHGIDQAISRGLAYAPYSDLIWCETATPNLEEAKKFADAIHKK
FPGKLLAYNCSPSFNWKKHLSDAEIATFQQKISEMGYKFQFITLAGFHTQNIAIFELAEK
YKTEGMTAYSKIQELEFAREKDGYTSVKHQREVGTSYFDAVSNTISSGKSSTTAMAGSTE
SEQF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgagaacatctcatacgatttaaaaagatttgcaggaattaaaagagattat
accccagaagaggttgagagattaagaggttcatttaaaattgaatactctatgtgtaaa
caccaatccaaaaaattatgggatttgttaaattcagaaaattatattaatacattggga
tctctatcgggaaaccatgctattcaacatgcaaaagctggattaaaagcaatttattta
agtggatggcaagtagcagctgatgcaaatacggctggtgaaatgtatccagatcaatcc
ttatatccatatgatagtgcgccaaaattagttgagtcgatgaataatgcattaattaga
gcagatcaaattcagcatatggaattacaagatggtgaaatgaaatcaaatgatagaaca
gattatatgttgcctattattgcagatggtgaagcaggttttggtggtccattaaatgtt
tttgaattagcaaaaaaatttattaaagcaggtgcggctggagttcactttgaagatcaa
ttagctagcgaaaaaaaatgtggccatatgggtggaaaagttttagttccaactggcact
atgattaaaaacttaaaagctgcaagacttgcagcggatatcgcagatgtacccttaata
attttagcaaggactgacgctaatgctgcaaaattaattacgaatgattttgatgaaaat
gataaaccatttttaactggtgaaagatcaccagaaggtttttattatgttaaacacgga
attgatcaagcaatttccagaggtttagcatacgcgccttattcagatttaatctggtgt
gaaactgcaacaccaaacttagaagaggcaaaaaagtttgcagatgcaattcataaaaag
tttcctggtaaattattagcttacaattgctccccctcattcaattggaaaaagcattta
tcagatgctgagattgcaacatttcagcaaaaaattagtgagatgggatataaattccaa
tttataactcttgcaggatttcatactcaaaatattgcaatttttgaacttgctgaaaaa
tataaaacagaaggaatgactgcttattctaaaatccaagagcttgagtttgctagagaa
aaagatggctatacaagtgttaaacaccaacgagaagttggaacatcttattttgatgca
gtttcaaataccataagtagtggaaaaagttctacaactgctatggcaggatcaacagaa
tctgagcagttttaa

DBGET integrated database retrieval system