KEGG   Candidatus Pelagibacter ubique: SAR11_1367
Entry
SAR11_1367        CDS       T00257                                 

Name
(GenBank) hypothetical transport protein
Organism
pub  Candidatus Pelagibacter ubique
SSDB
Motif
Pfam: EamA DUF2231
Other DBs
NCBI-ProteinID: AAZ22170
UniProt: Q4FKW8
Position
complement(1299633..1300532)
AA seq 299 aa
MINKNNVAYIFLFLAALFWSGNFLVGKFASQYQVPPFSLNFYRWLFAWLILAPFTIQELF
NKRSYILENYKYYTILGITSVTIFNSIVYYSLNFTQVISGVLMISTIPVMIIFISSILKI
EKTNTFQIMGVTCSFIGVVLIITKANLGILMNLDFNKGDITMVFGMLSWATYSALLKKKK
HELSQLGLLEVVISFGFIFLIPIYFIEYQMGFRIVLNQNFYMILFYVVLFPGLASFIFWI
KGVALIGANRAGVFLHMMPILSAIMAMIIFNEKFMFYHMLGAIFILTGILLSNRKIKNA
NT seq 900 nt   +upstreamnt  +downstreamnt
gtgataaataaaaataatgttgcttatatttttttatttttagcagctttattttggtca
ggaaattttttagttggaaaatttgctagtcaatatcaagtacctccattttcattaaat
ttttatagatggctttttgcttggttgatcttagctccatttacaattcaagaactattt
aacaaaagaagttatattttagaaaattataaatattacacaattcttggaataacgagc
gtcactatctttaattcaattgtctattattctttaaactttacgcaagtaatcagtgga
gtgttgatgatatcaacaataccagtgatgatcattttcatttcttcaattttaaaaatt
gaaaaaactaatacttttcaaataatgggcgttacatgttcttttattggagttgtttta
attataaccaaagcaaatcttggaatattaatgaatttagacttcaacaagggtgacatc
acgatggtttttggaatgctttcttgggctacttattcagctcttttaaagaaaaaaaaa
cacgaactatctcaactaggtttactagaagtagtaatttcatttggctttattttttta
ataccaatttactttatagagtatcaaatgggctttagaattgttttaaatcaaaacttt
tacatgattttattttatgtagttctatttccaggtcttgcttcttttattttttggata
aagggagttgctttaattggtgctaacagagcaggtgtttttttacatatgatgcctatt
ttaagtgcaattatggcaatgattatttttaatgaaaaatttatgttttatcatatgttg
ggcgcaatatttattttaacaggaattcttttatcaaacagaaagattaaaaatgcttaa

DBGET integrated database retrieval system