KEGG   Pelosinus sp. UFO1: UFO1_0207Help
Entry
UFO1_0207         CDS       T03211                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00071  Fatty acid degradation
puf00280  Valine, leucine and isoleucine degradation
puf00310  Lysine degradation
puf00362  Benzoate degradation
puf00380  Tryptophan metabolism
puf00620  Pyruvate metabolism
puf00630  Glyoxylate and dicarboxylate metabolism
puf00640  Propanoate metabolism
puf00650  Butanoate metabolism
puf00900  Terpenoid backbone biosynthesis
puf01100  Metabolic pathways
puf01110  Biosynthesis of secondary metabolites
puf01120  Microbial metabolism in diverse environments
puf01130  Biosynthesis of antibiotics
puf01200  Carbon metabolism
puf01212  Fatty acid metabolism
puf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UFO1_0207
   00630 Glyoxylate and dicarboxylate metabolism
    UFO1_0207
   00640 Propanoate metabolism
    UFO1_0207
   00650 Butanoate metabolism
    UFO1_0207
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UFO1_0207
   00072 Synthesis and degradation of ketone bodies
    UFO1_0207
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UFO1_0207
   00310 Lysine degradation
    UFO1_0207
   00380 Tryptophan metabolism
    UFO1_0207
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UFO1_0207
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UFO1_0207
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UFO1_0207
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:puf04147]
    UFO1_0207
Enzymes [BR:puf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UFO1_0207
Exosome [BR:puf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UFO1_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIF49768
UniProt: A0A075KBZ7
Position
251273..252454
Genome map
AA seq 393 aa AA seqDB search
MKEVVIVSAVRTAVGSFNGSLAPFAAVDLGAIVIKEVIARGGINADQVEEVIFGNVLQAG
LGQNPARQAAVKAGIPVEVSAYTINKVCGSGLKSVNLAAQAIMTGEADIVIAGGMESMTN
AAYVLDTKARWGLRMGNAKVVDTMIQDGLWCAFNDYHMGITAENVAEKYGISREQQDQLA
VESQQKAVQAIADGAFKEEIVPIVIKTKKGEVIFDTDEFPRAGTTAEKLSGLKPAFKKEG
TVTAGNASGINDGAAAILLMSADKAKELGITPLARIRSFGSGGVDPSIMGMGPVSATRKA
LAKAGLTVADLDLVEANEAFAAQFLAVGQELGFAKEKVNIHGGAIAIGHPIGASGARILV
TLLHGMKQKDAKVGLATLCIGGGQGVATIVELV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagtaattgtaagtgctgtacgtactgccgtaggtagttttaatggctcc
ttggcaccttttgcggcagttgacttgggagcaattgttattaaagaagtaattgctcgt
ggtggtatcaacgcagatcaagttgaagaagtgattttcggtaatgtattacaagctggt
ctggggcaaaaccctgctcgccaagcagcagttaaagctggtatacctgttgaagtatcg
gcttatacgataaataaagtatgtggctctggactgaaatctgtaaatctagcagcacaa
gcgattatgacaggcgaggcagatattgtaatagcaggtggaatggaaagcatgaccaat
gccgcctatgtgctcgatactaaggcgcgttggggacttcgtatgggcaatgcaaaagtt
gttgatacgatgatccaggatggtctgtggtgtgcatttaatgattaccatatgggtatt
accgctgaaaatgttgcagaaaagtatggtattagccgtgaacaacaagatcaattagca
gtagaatcccagcaaaaagctgttcaagcaattgcagatggtgcatttaaagaagaaatt
gtaccaattgttattaagactaaaaaaggtgaagttatttttgatacagacgaattccct
agagcagggacaacggctgaaaaattgagtgggctaaagcctgcctttaagaaagaaggg
acagttactgctggcaatgcttctggtattaatgatggggcagcggccatattgctcatg
tcggctgataaagcgaaagaattaggtattacgccgttagcaaggattcgctcttttggc
tcgggaggtgtcgatccaagcattatggggatgggacctgtgtcagctactcgtaaggca
ctggctaaggctggtttaacagtagcagatcttgatttagttgaagccaatgaggctttc
gcagctcagttcttggcggtaggtcaagaactcggttttgctaaggaaaaagttaatatc
catggtggagcgattgcgattggacatccgataggagcaagtggagctcgtattttggta
acacttttacacggaatgaagcaaaaggatgcaaaagtaggcttggcaaccttatgtatt
ggtggtgggcaaggcgtagcaacaattgtagagttagtataa

DBGET integrated database retrieval system