KEGG   Pelosinus sp. UFO1: UFO1_0262Help
Entry
UFO1_0262         CDS       T03211                                 

Definition
(GenBank) protein of unknown function DUF1498
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UFO1_0262
Enzymes [BR:puf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     UFO1_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: AIF49823
UniProt: A0A075KC62
Position
307887..308576
Genome map
AA seq 229 aa AA seqDB search
MKRSEINNIIEYTIKATEKSKIPLPPFAYYTLDDWKGIKEDQREIVDNMLGWDVTDFGRN
NFNHTGLTIFTFRNGNFNNKNKYPKPYCEKLLFVRDGQILPFHFHWHKMEDIINRGGGTL
KITLYNSNVNEDFDDSDVEVTIDGKVEKIKAGENIFLKPGQSITLGTGQYHQWQGVPGTG
DIALFEVSTTNDDRIDNRFYEVKSRLPEVEEDAIAKYLIFNDYGKYVGF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatcagaaataaacaatattattgaatataccattaaagcaactgaaaaatct
aaaattccgctgcctccatttgcttattatactctcgatgattggaaaggcataaaagaa
gatcagcgtgaaatagttgataatatgttaggatgggatgttactgattttggcagaaat
aattttaaccatactggattaacaatatttacatttagaaatggtaattttaataataaa
aataagtatccaaaaccgtattgtgagaagttattatttgttcgtgacggacaaatctta
ccttttcattttcattggcacaaaatggaggatatcattaaccgaggtggcggtacatta
aaaattactctatataattcaaatgtgaatgaagattttgatgatagcgatgtagaagtt
actattgatggaaaagtcgaaaaaataaaagcgggtgaaaatatttttcttaaaccaggt
caaagtatcactttaggcacaggtcaatatcatcaatggcaaggtgttcctggtacaggt
gatattgcgttatttgaagtttctacaactaatgacgatagaatagacaatcgtttttat
gaagtcaaatcacgtcttcctgaagtagaagaagatgcgattgcaaagtatctaatattt
aacgattacggaaaatatgtaggattctaa

DBGET integrated database retrieval system