KEGG   Pelosinus sp. UFO1: UFO1_1835
Entry
UFO1_1835         CDS       T03211                                 

Definition
(GenBank) Xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00230  Purine metabolism
puf01100  Metabolic pathways
puf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UFO1_1835
Enzymes [BR:puf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     UFO1_1835
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AIF51386
UniProt: A0A075KB22
Position
2012211..2014493
AA seq 760 aa
MQSVGKDFPRIDGFAKVCGKAKYVDDFFERDMLHAKIFRSTIANGWVKRIDVSKAKAMSG
VEAVITFADVPKHTFPTAGHPYSKDPKHQDVADRHLLTQRIRLYGDEIAVVIAVDELTAE
KALRFIEVEYEEYKPILTAAEALEEGAIEIHEGTKNIIKKTDFCLGELEEAFLESDYVFE
DEFVTSMVQHCAMENHSAYSYIDENGKIVVVSSTQIPHICRRIIGQALGIPWGRARVIKP
YIGGGFGSKQDVVVEPLVAFLTTVVHGRPVKLEFSREETFIASRVRHPITFKFRTGVTKD
GTILARELKAISNNGSYASHGHSIVSNCLTKFRHLYSQKAIRGEATTVYTNLPAAGAMRG
YGIPQVTFGLESHMEDIARELKIDPIEFRLKNSNKEGYVDPLTGISARSNGLDECIALGK
KLIGWDEKKANSLKQTGSKRRGLGMACFCYKTGTYPFGLEIAGARIILNQDGSIQLQIGA
TEIGQGSDTIFAQMAAQTIGIPMDMVSVVSTQDTDITPFDTGSYASRQTYVSGMAVKKAA
EEIKMKVLNYAWGMTDIPASALTLVDGWVVYIHNGEKVMSIADVALDSYYDAVFAAPITA
DVTNNARTNALAFGCTFVEVEVDIPIAKVEVLAIYNVHDAGKLINPKLAHAQVHGGVSMA
LGYALYEQMLFDSKTGKPLNSNLLDYKLMTTLDTPEIGTAFIETYEPTGPYGNKALGEPP
AISPAPAIRNAIYDATGVKLYEVPMNPQRLFEKFKSTGLL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgcaaagtgtaggaaaagattttcctagaattgatggatttgctaaagtatgcggtaaa
gcaaaatatgtagatgatttttttgaaagggatatgctccacgcgaaaatttttcgtagc
acaattgccaatggatgggtaaaaagaattgatgtcagtaaagcaaaagcaatgtccggt
gtggaggcggttataacttttgcagatgttcccaaacatacattcccgacagccggtcat
ccctatagtaaagatccaaaacatcaggatgtggctgaccgccatcttttaacccagcgg
atacgtctatacggggatgagattgcagtcgtaattgccgtagatgaactgacagctgaa
aaagccttacgttttatcgaagttgaatatgaggaatataaacctattttaactgccgcg
gaagcattagaagaaggtgctattgaaattcatgaaggaactaaaaatatcataaaaaaa
actgacttttgcctaggagagctggaagaagcttttttagaatctgattatgtttttgaa
gatgaatttgtaacaagtatggtacaacattgcgctatggaaaatcatagtgcttattct
tatatagatgagaacggcaaaattgtcgtagtttcctctacacaaatcccccatatttgt
cgaaggattatcggccaagcgctaggaattccatggggaagagcgcgtgttattaaacct
tacattggtggaggatttggtagcaaacaggatgtagttgttgagcctcttgtcgccttt
ttaacaacggttgtgcatggaaggcccgtaaaacttgagttttctcgagaggaaaccttt
atagcctctagggtgcgccatcctattacatttaaatttagaacaggcgtaacgaaagac
ggtaccatcctcgctcgcgaactaaaggcgatttcgaataatggctcttatgcttctcac
ggacactcgattgtttctaattgtcttactaaatttaggcacctctatagtcaaaaagca
attagaggagaagcaactactgtatataccaatctacctgctgcgggtgctatgagggga
tatggaattcctcaggttacctttgggttggaatcccatatggaggatattgctagagaa
cttaagatagatcctatagagtttcgtttaaaaaatagtaacaaggaaggatacgtagac
cctctaactggtatttctgcccgtagtaatggacttgatgaatgtattgctttgggtaaa
aaactaattggctgggatgaaaaaaaggcgaattcgctgaaacaaacaggatcaaaacga
cgtggtttagggatggcatgtttttgttacaaaactgggacctatccttttgggctagaa
attgcaggtgccagaattattctaaatcaagatggttctattcagttacagataggtgcc
actgaaattggtcagggtagtgatacaatttttgctcaaatggcagcccaaactatcgga
ataccaatggatatggttagtgtggtttctactcaagacacagatattacacctttcgat
acaggctcctatgcttcaaggcagacctatgtttctggtatggctgttaagaaggcggca
gaagaaataaaaatgaaagtattgaattatgcttggggaatgacggatataccagcaagt
gcgctcactcttgtagatggctgggttgtttatatacataacggagaaaaagtaatgtcg
attgccgacgtggcattagatagttattatgacgctgtatttgccgcacccattactgcg
gatgtcacgaataatgctcgaacgaacgctttagcctttggttgtacctttgttgaagtc
gaagttgatattccgatagcaaaggtagaggttcttgcaatctataatgtacatgatgca
ggaaaactcattaaccctaaattagcccatgctcaagttcatgggggagtgagtatggcg
ctagggtacgcgttgtatgaacaaatgttatttgactctaaaacaggaaaaccattaaat
agtaatcttcttgactataaactgatgacgaccttagatacacctgaaattggtacggct
tttatagaaacctatgaacctacagggccatatggtaataaggctctaggggaaccgcct
gctatatcaccagctcctgccattcgtaatgcaatctatgatgccacaggtgtgaaatta
tatgaagttccgatgaatccacagcgcttgtttgaaaaatttaagtctacaggcttactg
tag

DBGET integrated database retrieval system