KEGG   Pelosinus sp. UFO1: UFO1_1837
Entry
UFO1_1837         CDS       T03211                                 

Definition
(GenBank) (2Fe-2S)-binding domain-containing protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00230  Purine metabolism
puf01100  Metabolic pathways
puf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UFO1_1837
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AIF51388
UniProt: A0A075KGI6
Position
2015386..2015892
AA seq 168 aa
MQLKKITFKINSKEITIEVDVRESLLDVLRNKLHMTGVKKGCSVGECGACTVLIDNVAFD
TCIYLAVWADGKEIRTIEGEAKEGKLSKVQQSFLDEAAVQCGFCTPGFVMSTTEMLESGK
VFSKEQIKKELSGHMCRCTGYHNIMLAAEKALQPANKHGSECHGKCHK
NT seq 507 nt   +upstreamnt  +downstreamnt
atgcaattaaaaaaaattacatttaaaattaatagtaaagaaatcactattgaagtagat
gtaagagagtccttgttggatgttttgagaaacaaacttcatatgacgggtgtaaaaaag
ggatgttctgttggtgagtgcggtgcttgtactgtacttattgataatgtggcctttgat
acttgcatctatcttgcagtttgggcggatggtaaggaaattagaaccatagagggagaa
gcgaaagaaggaaaattgtctaaggtacagcagagtttccttgatgaggcagctgtacaa
tgtgggttttgtacgccgggatttgtgatgtctactacagaaatgcttgaaagtggaaaa
gtgttttcaaaggagcaaataaaaaaagagttgtcagggcacatgtgccgatgcacaggc
tatcataatattatgcttgcagcagaaaaggctttacaacccgcaaacaaacacggttcg
gagtgtcatggaaaatgtcataagtaa

DBGET integrated database retrieval system