KEGG   Pelosinus sp. UFO1: UFO1_2208Help
Entry
UFO1_2208         CDS       T03211                                 

Definition
(GenBank) GHMP kinase
  KO
K16651  L-threonine kinase [EC:2.7.1.177]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UFO1_2208
Enzymes [BR:puf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.177  L-threonine kinase
     UFO1_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C AAA_19
Motif
Other DBs
NCBI-ProteinID: AIF51755
UniProt: A0A075KC84
Position
complement(2375559..2376458)
Genome map
AA seq 299 aa AA seqDB search
MRVTVKAPGSCGELAQGTINGKSFLITCPIDLYSKVTVMPNKDIGIVSIGNKVATAITKT
LQFLKIPNDGFHVSVKSELPLGKGMASSSADISAACQCIALSRGTLLSPDEIADIALSIE
PTDGIFYPGIILFDHVKGHLRRYLGHAIPMHIVIFDVGGEIDTLHFNQRSDLEKLNHSKE
LQVKQAMNLIINGLTKKDVFLLGKGATISALANQKILFKPHLEEIIDIGLSWGAVGVNVA
HSGTVVGVLFPANKLSNCPACIEEINRCCTGVKFLHTVNFISGGLMKQEGDSHEWEQCF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagggtaaccgtcaaagcccctggttcatgtggcgaattagcacaaggtacaatcaat
ggaaaaagttttttaattacttgtcctattgatttatactcaaaggtaacggtaatgcct
aataaagatattggtattgtatcaattggaaataaggtcgcaactgccatcaccaaaaca
cttcagtttttaaaaatccctaatgatggttttcatgttagcgtaaaatctgaattacca
ctaggcaaaggcatggcttccagtagtgctgatattagtgctgcatgccaatgtattgcc
ttaagtagaggtacacttttatcacctgatgaaatagcagatatcgccctgtcaattgaa
cctacggatggtatattttaccctggtattatcttgtttgatcatgtaaagggacacctt
cgccgatacttaggacacgcaattccgatgcatatcgtaatctttgatgtaggcggcgaa
attgatacgctgcattttaatcaacggagtgatttagaaaaactaaatcattcaaaagaa
ttgcaagtaaagcaagcaatgaatttaattatcaacggccttaccaagaaagatgttttt
ctacttggtaaaggagctacaattagcgcattagcgaatcaaaagattttatttaaacca
catttagaagaaataattgacataggtctttcctggggagctgtaggagtaaatgttgct
catagtggtacagttgttggtgtgctcttcccagcaaataaactaagcaattgccccgct
tgtattgaagaaattaacagatgctgcaccggtgtcaaatttctgcatactgtaaatttc
atttctggcggattaatgaaacaagaaggtgacagtcatgagtgggaacaatgcttttga

DBGET integrated database retrieval system