KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0160Help
Entry
NT08PM_0160       CDS       T02057                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
pul00051  Fructose and mannose metabolism
pul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NT08PM_0160
Enzymes [BR:pul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     NT08PM_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP GerD
Motif
Other DBs
NCBI-ProteinID: AFI45322
Position
complement(149421..150578)
Genome map
AA seq 385 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADSGIQVIFADVNDHVIEQLKTQRAYPVKIVGDRLNVIET
VSNVTGVNSKNEADIIACFTEVNLVTTAVGPNVLKIISSTIAKGLSARFRAGNTRPLNII
ACENMVRGTSFLKDNVFSYLTPEEQQQAEAQIGFVDSAVDRIVPPVQFDSANPLLVTVEE
FSEWIVDKTQFKGTIPAITGMEQTDNLMAFVERKLFTLNTGHATTAYLGKLKGHQFVKDS
IDDPDIREAVKATMQESGAVLIKRYGFDPHAHAAYIEKILKRFANPYLQDDVDRVGREPL
RKLSYNDRLIKPLRGTLEYGLPNQHLIQTIASALAYRNESDPQAVELAQLLQQDALESAV
KKITELTESNIVQQIVTAYNALQKN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggtgcgggtaatattggacgtggatttatcggaaaattatta
gctgatagtggtattcaagtcatctttgccgatgtcaatgatcatgttattgagcaactc
aaaacacaacgggcttatccagtcaaaattgttggcgatcgcctgaatgtaattgaaacc
gtgtcaaacgtcacaggagtcaattctaaaaatgaggcggatattattgcatgctttact
gaagttaatttagtgaccaccgcggtgggacctaatgtattaaaaatcatttcaagcact
attgcaaaaggcttaagcgcacgttttcgtgcaggaaatacccgcccattaaatattatt
gcatgtgaaaatatggtgcgaggtaccagctttttaaaagacaatgtgttctcttatctc
acccctgaagaacagcaacaagcggaagcacagattggctttgttgattctgccgttgat
cgcatcgtgccaccagtacagtttgattccgccaacccgttattagtgacagttgaagag
ttcagtgaatggattgtagataaaacccaatttaaaggtacaattccagctattactggt
atggaacaaacggataatttaatggcatttgttgagcgtaaactgtttacattaaatact
ggacacgccacgaccgcctatttaggcaaattaaaaggtcaccaatttgtcaaagacagc
attgatgatccagatatcagggaagccgttaaagccacgatgcaagaaagtggtgccgta
ttaattaaacgttatggttttgatcctcatgcccatgcggcttacattgaaaaaatcctg
aagcgttttgccaatccgtatttacaagatgatgttgatcgtgtgggcagagaaccttta
cgaaaactcagctataacgatcgtttaatcaaaccattacgtggcaccttagaatatgga
ttaccaaatcaacatttaattcaaaccattgctagtgccttagcctatcgcaatgagagt
gatccacaagcagttgaattagctcaacttttacagcaagatgcgctcgaaagtgcggtg
aaaaaaatcactgaactgacagaatcaaacattgtgcaacaaatcgtaactgcttataat
gccttgcaaaaaaactaa

DBGET integrated database retrieval system