KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0827Help
Entry
NT08PM_0827       CDS       T02057                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Brite
KEGG Orthology (KO) [BR:pul00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pul03016]
    NT08PM_0827
Enzymes [BR:pul01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     NT08PM_0827
Transfer RNA biogenesis [BR:pul03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    NT08PM_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AFI45962
Position
complement(875311..876042)
Genome map
AA seq 243 aa AA seqDB search
MTLEILYQDPYLIAVNKPAGMLVHRSWLDRHETQFVMQTLRDQIGQHVYPIHRLDRPTSG
VLLFALSSEVANLLCLQFENKQVQKSYLAIVRGYLVGEGRIDYPLKVQLDKIADKFAQDD
KVPQEAVTDYLGLAKVEMPYCVKKYSTTRYSLVRLIPRTGRKHQLRRHMKHLFHPILGDT
QYGDLHQNRALTAHTGVQRLMLHAERLIFTHPITQQLITICAGVDQQWLDLINIFDWDLN
SIH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgacattagagattttatatcaagatccatatttgattgctgtaaataaaccagcaggt
atgttagttcatcgtagttggttagatcggcatgaaacacaatttgtcatgcaaacatta
cgcgatcaaatagggcagcatgtttatcctattcaccgtttagatcgaccgacttcaggt
gttttacttttcgcattaagtagcgaagtggcaaatttattgtgtcttcaatttgaaaat
aagcaagtgcaaaaaagttatttagcgattgttcgaggatatttagttggtgaggggcga
attgattatccactgaaagttcaattagacaaaattgcggataagtttgcccaagatgac
aaggtgccacaagaagcggtgacagattatctcgggttagctaaagttgaaatgccgtat
tgtgtgaaaaagtactcaacaacgcgttattcgcttgtgcgtttaattccgcgtacgggg
cgaaaacatcagctgcgtcgtcacatgaaacacctttttcatcctattttgggagataca
caatatggtgatttacaccaaaatcgtgcattaaccgctcatacgggcgtgcaacgttta
atgttacatgcagaacgattgatttttacacacccgataacacagcaactgatcacgatc
tgtgcgggtgtcgatcaacaatggctcgatttgattaatatttttgattgggatttaaat
tccatacattaa

DBGET integrated database retrieval system