KEGG   Psychrobacter urativorans: AOC03_04405Help
Entry
AOC03_04405       CDS       T04087                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
pur  Psychrobacter urativorans
Pathway
pur00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    AOC03_04405
Enzymes [BR:pur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     AOC03_04405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Sacchrp_dh_NADP HHH_5 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: ALF59388
UniProt: A0A0M5TIS5
Position
complement(1012557..1013348)
Genome map
AA seq 263 aa AA seqDB search
MQEFTHKTFNELFDLSGKVAIVTGGANGIGKATALRLAEAGANIAIADLKLEDAQAAVKD
IEALGVKALAVECNILKDDDLVAMVDKVVAEFGTINILINNAGGGGGGRENPTTASVDDI
RRDFELNVFSGWRLSQLCAPHMKDSGYGSIVFTTSMSSINKSPNMSGYAGSKAAVNHMVA
NLAHDFGPEVRVNAVGPGATRTDALKTVLTPEIEKKMLANTPIKRLGEADDIAGAMLYFA
APISTWVSGQTIFVNGGGVQTLD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatttactcataaaacatttaacgaactatttgatttgtcaggtaaagttgcg
atagtcaccggtggcgctaacggtattggtaaggcaaccgcgctgcgtttggcagaagcg
ggtgctaacattgccattgcagatttaaaacttgaagatgcacaagcagcggtaaaagat
attgaggcgcttggggtaaaagcgcttgccgtagagtgtaatattttaaaagatgatgac
ttggttgctatggtcgataaagtggtcgctgaatttggtaccattaatattctgattaat
aacgcgggtggcggtggcggtggtcgtgaaaacccaactacggcatcggttgatgatatt
cgacgtgattttgaattaaacgtttttagtggctggcgcttaagccagttgtgcgcgcca
catatgaaagattcagggtatggctcgattgtattcacgacttcgatgtcgagtatcaat
aaaagcccgaatatgagtggctatgcaggctcaaaagcagctgttaatcatatggtggca
aacttagcgcatgattttggtcctgaagtgcgcgttaatgcggttggtcctggtgccaca
cgtacggatgctttgaaaaccgtactaacaccagagattgaaaagaaaatgctcgcaaat
acgcctattaagcgtttgggtgaggctgatgatatcgctggtgctatgttgtattttgcg
gcaccgatatcgacttgggtcagtggtcaaaccatattcgtgaatggtggcggtgtacaa
accttagattaa

DBGET integrated database retrieval system