KEGG   Psychrobacter urativorans: AOC03_11265Help
Entry
AOC03_11265       CDS       T04087                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pur  Psychrobacter urativorans
Pathway
pur00071  Fatty acid degradation
pur00072  Synthesis and degradation of ketone bodies
pur00280  Valine, leucine and isoleucine degradation
pur00310  Lysine degradation
pur00362  Benzoate degradation
pur00380  Tryptophan metabolism
pur00620  Pyruvate metabolism
pur00630  Glyoxylate and dicarboxylate metabolism
pur00640  Propanoate metabolism
pur00650  Butanoate metabolism
pur00900  Terpenoid backbone biosynthesis
pur01100  Metabolic pathways
pur01110  Biosynthesis of secondary metabolites
pur01120  Microbial metabolism in diverse environments
pur01130  Biosynthesis of antibiotics
pur01200  Carbon metabolism
pur01212  Fatty acid metabolism
pur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pur00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOC03_11265
   00630 Glyoxylate and dicarboxylate metabolism
    AOC03_11265
   00640 Propanoate metabolism
    AOC03_11265
   00650 Butanoate metabolism
    AOC03_11265
  Lipid metabolism
   00071 Fatty acid degradation
    AOC03_11265
   00072 Synthesis and degradation of ketone bodies
    AOC03_11265
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOC03_11265
   00310 Lysine degradation
    AOC03_11265
   00380 Tryptophan metabolism
    AOC03_11265
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOC03_11265
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOC03_11265
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AOC03_11265
Enzymes [BR:pur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOC03_11265
Exosome [BR:pur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOC03_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALF60876
UniProt: A0A0M4U8P2
Position
complement(2637666..2638928)
Genome map
AA seq 420 aa AA seqDB search
MLGGNRIPFARSNGAYADASNIDMLTAALNGLIERYNLQDEKVGEVVAGAVMKLSRDINL
TREAAFNTALDPHTPTYDIAQACGTGLQATFASANKIALGIIDSAITGGVDTTSDAPIAI
GDGLRKVIIKLGAAKNNKQRLQALLSLNPTDLIDSPQNGEPRTGLSMGDHQAITALEWNI
SREDQDKLAFNSHKNLARAYDDGFFDDLITPYKGLTRDDNLRPDSTLEKLGTLKPVFGKH
NANPTMTAANSTPLTDGASCLLLGNDDWAEAHGLKPLAYIVHQETAAVDFIGKSGNKEGL
LMAPAYAVPRMLERAGLSLQDFDFYEIHEAFASQVLSTLSAWEDETFCQERLGLDAPLGS
IDRDKLNVNGSSLAAGHPFAATGGRILATAAKLLDQKGAGRALISICAAGGQGVTCILEK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atcttaggtggtaatcgtattccatttgctcgctcgaacggtgcttatgcggatgccagt
aacattgatatgctgaccgcggcgctgaatggtctgattgagcgctataatttacaagat
gagaaagttggcgaagtcgttgctggtgcagtcatgaagctaagccgcgatatcaaccta
acgcgtgaagccgcctttaataccgcgctcgacccacatacccctacttatgatatcgcg
caagcttgtggcactggtctacaagccacgttcgcttctgccaataaaattgcgcttggt
atcattgattcagccattactggcggtgttgacacgacctcagatgcgcctattgctatt
ggtgacggtctgcgtaaagtcatcattaaactgggcgctgcgaagaataacaagcaacgt
ctacaagcattgctgagtttgaatccaacagatttaatcgattcaccgcaaaacggcgag
ccgcgtactggtttatcaatgggcgatcatcaagctattaccgcgcttgagtggaacatc
agccgtgaagaccaagataagctggcattcaatagccacaaaaacctagcccgtgcttat
gatgatggcttctttgatgatttgattaccccttataaagggttaacgcgtgatgacaac
ttacgtcctgactctactcttgaaaaactgggtacgcttaaaccggtatttggtaagcat
aatgccaatccaaccatgacagcagcgaactcaacgccattgaccgatggtgcatcttgc
ctgttattgggtaatgatgactgggcggaagcgcacggattaaaaccactagcttatatc
gtccatcaagaaacggcagcggtagacttcatcggtaaatctggtaataaagaaggtctg
ctcatggcgccagcgtatgccgtaccgcgtatgcttgaacgtgctggattgagcttacaa
gactttgatttttatgagattcatgaagcatttgcgtcacaagtgctatcgactttaagt
gcatgggaagatgaaaccttctgccaagagcgcttgggtcttgatgcgccattaggctct
attgaccgtgacaaactgaacgttaatggttcatcactggcggctggacatccttttgcc
gccacgggtggtcgcattttagccactgctgcaaaactgcttgaccaaaaaggggcagga
cgcgcactgatttctatttgtgcggcgggcggtcaaggcgtgacttgtatcttagaaaaa
taa

DBGET integrated database retrieval system