KEGG   Pusillimonas sp. ye3: CKA81_07070Help
Entry
CKA81_07070       CDS       T05795                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pus  Pusillimonas sp. ye3
Pathway
pus00520  Amino sugar and nucleotide sugar metabolism
pus01100  Metabolic pathways
pus01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CKA81_07070
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CKA81_07070
Enzymes [BR:pus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CKA81_07070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 vWF_A PEP_mutase
Motif
Other DBs
NCBI-ProteinID: QAA93624
UniProt: A0A410GBG0
Position
complement(1478355..1479413)
Genome map
AA seq 352 aa AA seqDB search
MTANSTSGRLPPGPVMVDVEGTVLTDHERKRLRDPLVGGVILFARNFEDREQLDRLCRAI
HQERDEPLLIAVDHEGGRVQRFRTDGFTPIPAMSVFGELWSEDSLAAMRLASEAGYVLGA
ELRACGVDLSFTPVLDLDYGVSKVIGNRAFHRDPRVVTMLARALIQGLMLAGMAACGKHF
PGHGAVEADSHHEIPVDPRDFETIMQEDAAPYGWLGDMVLPSVMPAHVVYPEVDPHPAGF
SRHWIQKVLRQDLGYDGVVFSDDLTMEGATVAGDILARAQAALGAGCDMVLVCNRPDLAD
DLLARLAFDHDAASVARIRRLLPQQAAPGWDALQADERYQYARRLQSQIVSG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgaacagcacgtcgggccgcctgccgcccggtcccgttatggtcgacgtggaa
ggcactgtgctgaccgaccacgaacgcaagcgcctgcgcgatcccttggtaggcggcgtc
atcttgtttgcgcgcaacttcgaggaccgcgaacaactggatcgcttgtgccgcgcgatt
catcaagagcgggacgagccgctgctgatcgcggtggatcatgaaggggggcgggtgcag
cgttttcgcaccgatggtttcaccccaattccagccatgagcgtctttggcgaactatgg
tcggaagactcgctggcagccatgcgtctggcatcggaagccggttatgtactgggagcc
gaattgcgcgcctgcggggtggacctgagcttcacaccggtcctggatctggactacggc
gtcagcaaggttatcggcaatcgcgcctttcatcgcgatccgcgtgtcgtcaccatgctg
gcgcgcgccttgatccagggcttgatgctggccgggatggcggcttgcggtaagcatttt
cccggccacggtgcggtggaggccgactcgcatcatgaaattccggtggacccccgtgat
tttgaaaccatcatgcaggaagacgcggctccgtatggctggctaggcgacatggtgctg
ccatccgtaatgccggctcatgttgtttaccccgaggtcgacccacatcctgccggcttc
tcacgccactggatacagaaagtgctgcgccaggacctcggctatgacggggtggtgttt
tcggacgacctgacaatggaaggcgcgacggtggccggcgacatcctggcgcgtgcgcaa
gctgcgctgggcgctggctgcgatatggtcctggtatgcaatcggcccgatcttgccgac
gatttgctggcgcgtctcgccttcgatcatgatgcggcgtccgtggcgcgtatccgccgg
ttgctgccacaacaggcggcacccggctgggatgcgctgcaggccgatgaacgttatcaa
tatgcccgacgacttcaatctcaaatcgtttctggctga

DBGET integrated database retrieval system