KEGG   Pusillimonas sp. T7-7: PT7_0052Help
Entry
PT7_0052          CDS       T01486                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00071  Fatty acid degradation
put00280  Valine, leucine and isoleucine degradation
put00281  Geraniol degradation
put00310  Lysine degradation
put00360  Phenylalanine metabolism
put00362  Benzoate degradation
put00380  Tryptophan metabolism
put00410  beta-Alanine metabolism
put00627  Aminobenzoate degradation
put00640  Propanoate metabolism
put00650  Butanoate metabolism
put00903  Limonene and pinene degradation
put00930  Caprolactam degradation
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01120  Microbial metabolism in diverse environments
put01130  Biosynthesis of antibiotics
put01212  Fatty acid metabolism
Module
put_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PT7_0052
   00650 Butanoate metabolism
    PT7_0052
  Lipid metabolism
   00071 Fatty acid degradation
    PT7_0052
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PT7_0052
   00310 Lysine degradation
    PT7_0052
   00360 Phenylalanine metabolism
    PT7_0052
   00380 Tryptophan metabolism
    PT7_0052
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PT7_0052
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PT7_0052
   00281 Geraniol degradation
    PT7_0052
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PT7_0052
   00627 Aminobenzoate degradation
    PT7_0052
   00930 Caprolactam degradation
    PT7_0052
Enzymes [BR:put01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PT7_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 DUF5076
Motif
Other DBs
NCBI-ProteinID: AEC18592
UniProt: F4GTY3
Position
59429..60196
Genome map
AA seq 255 aa AA seqDB search
MSDLVKVDVIDRIQVITINRPEARNAINYETAQELARALECMDASDDIVMGVLTGAGNTF
SSGMDLKAFARGGQRPYVEGRGFAGVCEKPPVKPMIAAVEGYALAGGFEIALSCDLIVAA
RNANFGLPEVKRGIVAGAGGMLRLPSRIPYHIAMEAILTGEMFSAERAQSYGLVNRLVEP
GQTLDAALELARVVAANGPLAVQTAKSIVTQSRDWSQAEMFDLQRPRIAHIFTSADAKEG
ATAFAEKRNPVWTGK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacttggttaaagtggatgttattgaccggatacaagttatcacgatcaaccgg
cccgaggcgcgcaatgccatcaactacgaaacggctcaggagttggctcgggcgcttgaa
tgcatggatgcttccgacgatatcgtcatgggcgtgctgacaggggcaggcaacactttt
tcatccggtatggatcttaaagcctttgcccgcggcggccagcgcccctatgtcgagggc
aggggttttgccggcgtgtgcgaaaaaccgcctgtaaagcccatgattgctgcggtcgaa
gggtatgccctggcgggtggcttcgagatagcgctttcctgtgacctgattgtcgccgcc
cgtaatgccaattttggcttgcccgaagttaaacgaggcattgttgcgggcgccggtgga
atgttgcgcttgcccagccgcattccctaccacattgccatggaagccatcctgactggc
gagatgttttcggccgaacgcgctcagagctatggtctggtcaaccgcctggttgaacca
ggccagacactggatgcggccctcgagctggctcgcgttgtggcggccaatggtccgctg
gccgtgcagacggcaaaaagcatcgtgacccagtcccgagactggagccaggccgaaatg
ttcgatttgcagcgcccgcgtatcgcccatattttcacttcggctgacgccaaggaaggc
gcaaccgctttcgccgagaagcgtaatccggtatggaccggcaagtaa

DBGET integrated database retrieval system