KEGG   Pusillimonas sp. T7-7: PT7_0129Help
Entry
PT7_0129          CDS       T01486                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00010  Glycolysis / Gluconeogenesis
put00620  Pyruvate metabolism
put00640  Propanoate metabolism
put00680  Methane metabolism
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01120  Microbial metabolism in diverse environments
put01130  Biosynthesis of antibiotics
put01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PT7_0129
   00620 Pyruvate metabolism
    PT7_0129
   00640 Propanoate metabolism
    PT7_0129
  Energy metabolism
   00680 Methane metabolism
    PT7_0129
Enzymes [BR:put01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PT7_0129
Lipid biosynthesis proteins [BR:put01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PT7_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEC18669
UniProt: F4GUL9
Position
142514..144151
Genome map
AA seq 545 aa AA seqDB search
MLPLNPKSYDDISQRFSWDIPPRYNIGVDVCDKWAEQDSARLALIHIGHDGAVRNCSFGE
LLEMSNRVGNLLLAQGVEPGDRVGILLPQAPETAFGHIAAYKTGCIAIPLFALFGVEALL
YRLKDSGARVVITNAEGAAKLAQIGDQLPDLQVVFTIDGAHDGTLDLHREAARHSSDLTP
VDTAADDPAVIIYTSGTTGQPKGALHAHRVLLGHLPGVEISHNLFPQEGDRMWTPADWAW
IGGLFNVLLPSWHHGIAVVAHRFQKFTPEAAFQLIQDHGIRNTFLPPTALKMMRTVAEPE
KRWNYQLRSVASGGESLGAELLDWGRRTFGLTINEFYGQTECNMTVSSCADLMPVSPGAI
GRPVPGHRVAIIDEGGNVLGPGETGNIAVHSPDPVMFLQYWNNTRATREKYIGEWLVTGD
TGSVDDDGYIHFMGRNDDVITSAGYRIGPGEIEDCILQHASVKMVAVVGAPDPQRTEIVA
AVIVLKETYEANEALKREIQDYVKTRLAAHEYPREIFFVDELPMTTTGKVIRRELRQQVE
AWRQA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttgccattgaatcccaagagctacgacgatatcagtcagcgtttttcctgggacatt
ccgccgcgctacaacatcggggtcgatgtatgcgacaagtgggccgaacaagactcagcg
cgcctggccttgattcatatagggcacgatggcgctgtccgaaactgcagttttggcgag
cttcttgaaatgtcgaaccgtgtcggcaatctgctcctggcgcagggggtcgagcccggc
gacagggtgggcattcttctgccccaggcgcccgaaaccgcatttggtcatattgccgcc
tataaaacaggctgtatcgccattccgctgtttgcgctatttggggtcgaggccctgtta
tatcgtttgaaagacagcggtgcgcgtgtcgttatcaccaatgccgagggcgccgccaag
ctggctcaaataggcgaccaattacccgatttgcaggtcgtgttcaccatagatggcgcc
cacgatggcactctggacctgcaccgcgaggccgcaaggcatagctcagacctgacgccg
gttgatacggcggctgatgatcccgcagtcattatctacacctctggcacgaccggccag
cccaaaggcgccttgcatgcacatcgcgtgctgctgggccatttgccgggcgtggaaatt
tcacataatctttttccgcaggaaggcgaccggatgtggacgccggccgattgggcctgg
atcggcggtttgttcaatgttctgctgccgtcctggcatcacggtattgcggtcgttgcg
caccgtttccagaagttcacacccgaagcggcttttcagcttattcaagatcacggtata
cgcaatacctttttgccacccacggccttgaaaatgatgcgtacggtggccgagcccgaa
aaacgctggaactaccaattgcgttccgtggccagcggcggcgagtcgctgggcgccgag
ctgttggactgggggcggcgcaccttcggcctgaccatcaatgaattctacggccagacc
gagtgcaatatgaccgtgtcgtcttgcgccgacctgatgcctgtcagccccggagccata
ggccggcctgtcccgggccaccgggtcgccatcatagacgagggcggcaatgtgcttggc
cctggcgaaaccggcaatattgccgtacatagtcccgatcccgtcatgtttttgcagtac
tggaacaatactcgggcaacccgggaaaaatacataggcgagtggctcgttaccggcgat
accggcagcgtggatgacgatggctatattcatttcatgggccgcaacgacgacgtcatt
acttcggcgggctatcgtattggtcctggcgagatcgaagactgcatactccagcatgcg
tcggtcaaaatggtggccgtggtcggggcgcccgacccgcagcgcaccgagattgtggca
gccgtgatcgtgctgaaagaaacttacgaagccaatgaggcgctcaagcgggaaatacag
gactatgtaaaaacccggctggccgcgcatgagtatccgcgcgaaatattttttgtggac
gagcttcccatgaccaccacgggcaaggtcattcgtcgcgaactgcgccagcaagtcgag
gcatggcgccaagcctaa

DBGET integrated database retrieval system