KEGG   Pusillimonas sp. T7-7: PT7_0343
Entry
PT7_0343          CDS       T01486                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
put  Pusillimonas sp. T7-7
Brite
KEGG Orthology (KO) [BR:put00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:put02044]
    PT7_0343
Secretion system [BR:put02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PT7_0343
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEC18883
UniProt: F4GWL0
Position
401109..401660
AA seq 183 aa
MATSKSGQKFVARNRAPRVQIEYDVEIYGAERTINLPFVMGVMADLAGKSTQPQPEVAER
KFMDVDIDNFDDRMKAIKPRVAFHVPNTLTGDGQLAVDIEFNSINDFSPATVANKVEALK
GLLDARTELANLLTYMDGKTGAEELIGKVLENPALMGALAAAPKAPSETIEDSSDDDRTT
KQA
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcgaccagtaaaagtggacagaaatttgtagcgcgtaacagggcgccacgcgtacag
atcgagtatgacgttgagatttatggcgcggaacgcaccataaatttgccttttgtcatg
ggggttatggcggatctggcgggcaagtcgacgcagcctcaacccgaggtggccgagcgc
aagttcatggatgtcgatatcgataatttcgatgatcgcatgaaggccatcaagccaagg
gtggcatttcatgtgcccaatacgcttacgggcgatggccagttggcggtcgatattgaa
ttcaacagcatcaacgatttctctcctgcaacggtagcgaataaggttgaggccttgaaa
ggcctgctggatgcccgcacggaactggccaacttgctgacttacatggacggcaagacc
ggtgcggaagagttgataggcaaggtgctggaaaacccggccctgatgggcgcccttgct
gctgcccccaaagccccgtcagagacgatcgaagatagcagtgacgacgatcgcaccact
aaacaggcttga

DBGET integrated database retrieval system