KEGG   Pusillimonas sp. T7-7: PT7_0353Help
Entry
PT7_0353          CDS       T01486                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
put  Pusillimonas sp. T7-7
Brite
KEGG Orthology (KO) [BR:put00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:put02044]
    PT7_0353
Secretion system [BR:put02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PT7_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AEC18893
UniProt: F4GWM0
Position
411987..413318
Genome map
AA seq 443 aa AA seqDB search
MERKKVVWSEGMFLRPHHFQQLERHLEYRGSIHTECAAGLFWGFKTLQLDLDALALGKLA
LSQATGVFPDGTPFDFDSPDDAPVALDLPAGTHNKRVMLVVPRQRRGGQDVSFEDDDDKL
ARYCVMEEEIADSSAVALGPAVLQLGHLRLRLMLEDDVGGEWLALGVAVVLERRSDNRLL
LDQAYIPPTLAAGLNTVLRAYIHELYGLLEARSELLVQRLAEPGRGGVSEVSEFLLLKTI
NRYRGALWHAQQLETLHPERLFHDFLMLASDLATFSAEGRRLVSFPVYRHDELASSFEPV
MVLLRRSLSAILEDKAIQIPLEDKGQGVRVAHISDVAMLRTAGLVLAVHAQMPSELTRTR
LPAQAKLGPIERIRDLVHLQLPGIALRPLPNVPKPLPYHAGYIYFELEKNGEMWKQFERS
GGLALHLAGDFPGLQLEFWAIRE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaagaaggtggtttggtccgagggcatgtttctgcgccctcatcattttcaa
caactggaacggcatcttgagtatcgaggcagcatccatacggagtgtgccgcagggcta
ttctggggtttcaagaccttgcagctggacctggatgcacttgccctgggcaagctggca
ctgagccaggcaacaggcgtatttcctgatggaacgcctttcgattttgactctccggac
gatgcacccgtggcactggacctgcccgcaggcacgcataacaagagagtcatgctggtc
gtgcccaggcaacgtcgaggcggacaggacgtgtcgtttgaagacgatgacgacaagctg
gcgcgttattgcgtaatggaagaagagatcgccgactcaagcgcggtggcattggggccc
gcggtgctgcagttggggcatttgcgcttgcgcctgatgctggaagacgatgtgggcggt
gagtggctcgcactgggcgttgccgttgtgcttgagcggcgcagcgacaaccgcctgttg
ctggaccaggcctatattcctccgaccctggctgcaggccttaatacagtgttgcgtgcg
tatatccatgagctttatggcttgctggaagcgcgcagcgaattgctggtgcagaggctg
gccgaaccagggcggggcggtgtatcggaggtgtcggaattcctgctgcttaaaacaatc
aatcgctatcgcggcgcactgtggcacgcgcagcagctggaaaccttgcatccggagcgc
ctgtttcatgacttccttatgctggccagcgacttggcaacattttccgctgaggggcga
cgccttgtgtcattccccgtgtatcgacacgatgagctggcttccagtttcgagcccgtg
atggtgctgctgcgccgttccctatcagccattctcgaggacaaagccatacagattccg
ctcgaggacaaaggccagggtgtcagggtggcgcatatcagcgacgtggccatgttgcgt
acagccgggctggtgctggccgtacatgcccagatgccgtccgagctgacacgcacgcgt
ttgcccgcccaagccaagctgggccctatagagcgtattcgcgatctggtgcatttgcag
ctgcccgggattgcgctgcgacccctgcccaatgtgcccaagcctttgccttatcacgca
ggttatatctacttcgagctggaaaagaacggagaaatgtggaagcagttcgaacgctcc
ggtggcctggccttgcacttggcgggcgattttcccggccttcaacttgagttctgggca
atacgtgaatga

DBGET integrated database retrieval system