KEGG   Pusillimonas sp. T7-7: PT7_0476Help
Entry
PT7_0476          CDS       T01486                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00260  Glycine, serine and threonine metabolism
put00750  Vitamin B6 metabolism
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01120  Microbial metabolism in diverse environments
put01230  Biosynthesis of amino acids
Module
put_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PT7_0476
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PT7_0476
Enzymes [BR:put01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PT7_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEC19016
UniProt: F4GMB1
Position
554674..556083
Genome map
AA seq 469 aa AA seqDB search
MKYLSTRGGMTPQPFSDILLEGLAPDGGLALPESLPEVSVDTLEAWRKLSYADLATEILA
LFIDDIPKEDIARLTRAAYNADVFGSEQIVPLKPLNKGMTLLGLSEGPTLAFKDMAMQFL
GQVFEYVLDKRQATLNILGATSGDTGSAAEYALRGKRGVSVFMLSPHGRMSDFQRAQMYS
LQDPNIHNIALKGVFDECQDIVKALAGDLDFKARHSLGAVNSINWARIAAQVVYYFWGWL
RATNARGQQVSFAVPSGNFGNILAGHIARRMGLPVRRLVLATNENNVLEEFFRTGIYRPR
PASETHATTSPSMDISRASNFERFVFDLLGGDAGKVRACWDELAATGQFDLSAMLPEFES
RYGFVAGVSTHADRLKTIQIVQQETGVLIDPHTADGVKVAASYVEPGIPMLVLETALPAK
FGETIEAATGKPAPVPAHLQNLAALPQRVVVLDCKADLVRDYISRHAPA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacctgtctacccgtggcggcatgacgccgcagccgttttccgacattttgctg
gaaggcctggcgcccgatggcgggctggccttgccggaaagcctgcctgaggtcagtgtg
gatacgctcgaggcctggcgcaagctgagttatgccgatctggccaccgaaattttggcc
ttgttcatcgacgatatccccaaagaagatattgcacgcctcacacgcgccgcctataac
gccgatgtgtttggcagcgagcaaatcgtgccgctcaagccgctgaacaaagggatgacc
ttgctgggcttgtcggaagggccaaccctggcgttcaaggacatggccatgcagtttctg
ggccaagtcttcgagtacgtcctggacaaacgccaggccacgctgaacatactgggcgcc
acttcgggcgacaccggatcggccgccgagtacgccttgaggggcaagcgtggcgtatcg
gtgttcatgctttccccgcatgggcgcatgagcgactttcagcgggcgcaaatgtactcc
ttgcaagatccgaatatccacaacattgcccttaagggcgtgttcgacgaatgtcaggac
atcgtcaaggcactggcgggtgatctggacttcaaggccaggcacagcctgggcgcggtc
aactccatcaattgggcgcgtattgccgcccaggttgtttactacttctggggttggctg
cgtgccacgaacgcccgcggccagcaagtttccttcgccgtgccttcaggcaatttcggc
aatatcctggccggccatatcgcacgccgcatgggcctgccggtacgtcgcctggtgttg
gccaccaacgaaaacaatgtgctggaagagtttttccgtacgggtatctatcgtccgcgc
ccggcatcggaaactcatgcaaccaccagtccgtccatggacatttcccgtgcatccaat
ttcgagcgatttgtgttcgacttgctgggcggggatgccggcaaagtacgggcatgctgg
gatgagctggccgccacaggccaattcgacctaagcgccatgctgcccgagttcgagtcg
cgttatggctttgtggccggcgtcagcacccatgccgacaggctgaagaccatacaaatc
gtccagcaggaaaccggggtactgattgatccgcatacggccgatggtgtcaaagttgcg
gcgagctatgttgagcccggcattcccatgctggtgctggaaaccgccttaccagccaaa
tttggcgaaaccatcgaggcagccactggcaaacccgcgcccgttcccgcccatttgcag
aatctggctgcgctcccgcaacgtgttgtggtgctggattgcaaggcggatctggtgcgt
gactacatcagccggcacgcacctgcctga

DBGET integrated database retrieval system