KEGG   Pusillimonas sp. T7-7: PT7_0720Help
Entry
PT7_0720          CDS       T01486                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
put  Pusillimonas sp. T7-7
Pathway
put01040  Biosynthesis of unsaturated fatty acids
put01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PT7_0720
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PT7_0720
Lipid biosynthesis proteins [BR:put01004]
 Desaturase
  First
   PT7_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: AEC19260
UniProt: F4GPC8
Position
810157..811365
Genome map
AA seq 402 aa AA seqDB search
MDQILNFLKDGLLQFSWWQVALAALVLTHITIVGVTVFLHRSQAHRGLDLHPAVMHFFRF
WLWLTTGMVTKEWVAIHRKHHAKCEKEGDPHSPVVFGLGKVFFRGAELYREEATNPETLK
RFGHGTPDDWIERNLYTKHSLLGILIMLGIDLALFGVLGVTVWAVQMAWIPFWAAGVVNG
IGHAWGYRNFASPDTSTNVVPWGIIIGGEELHNNHHAYGTSAKFSTKWYEFDLGWLYISI
LSFLGLATVKKRAPKLKLEAPKPMADASTLQGVITHRYEILARYTDLVKKSAGEELNKLR
SSRKEGSPDCSWTLLSRCKDWITSNDDALEPAQREQVDTVLAQNQSLSTLVQMRRELVRL
WESSSSSSEQLLADLQAWCQRAQQSGIEGLEQFAYRLRRYAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaatacttaattttctaaaagacggcctgctccagttttcatggtggcaggtt
gccctggccgctctggtgcttacacacatcaccattgttggcgtaaccgtctttctgcat
cgtagccaggcgcaccgcgggctcgacctgcacccggccgtcatgcactttttccgcttc
tggctgtggctgaccaccggcatggtcaccaaagaatgggtggccatccaccgcaagcac
cacgccaaatgcgaaaaagaaggcgatccccactcaccggtggtgtttggcctgggcaaa
gtgtttttccgtggcgcagaactgtaccgcgaagaagccaccaaccccgaaaccctgaag
cgcttcggtcacggcacccccgacgactggattgagcgcaatctgtacaccaagcacagc
ttgctgggcattctgatcatgctgggcatagacctggccctgttcggcgtgctgggcgta
acggtatgggccgtacaaatggcctggatccccttttgggctgcaggcgtcgtcaatggt
atcgggcacgcctggggctatcgcaactttgccagccccgacaccagcaccaatgtggtg
ccctggggcattatcattggcggtgaagaactgcacaacaatcaccacgcctatggcaca
tcggccaagttctcgaccaagtggtacgagttcgacttgggctggctttatatttcgata
ctaagcttcttggggcttgccacggtcaagaaacgtgcgcccaagctcaagcttgaagcg
cccaaacctatggccgatgccagcaccttgcaaggcgtgatcactcaccgctacgagatc
ctggcccgctacaccgacctggtcaagaaatcggccggcgaagagctgaacaagctcaga
agcagccgcaaggaaggcagccccgattgcagctggaccttgctcagccgctgcaaagac
tggatcaccagcaacgacgacgctctggaacccgcgcagcgcgaacaggtagacaccgta
ctggctcagaaccagtcgctgtccaccctggtgcaaatgcgacgagagctcgtccgcctg
tgggaaagctccagctccagcagcgaacagctgttggccgatctgcaagcctggtgccag
cgtgcacaacaaagcggcatcgaagggcttgagcagtttgcttaccggttgcgccgctac
gcggcatga

DBGET integrated database retrieval system