KEGG   Pusillimonas sp. T7-7: PT7_1453Help
Entry
PT7_1453          CDS       T01486                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00520  Amino sugar and nucleotide sugar metabolism
put01100  Metabolic pathways
put01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PT7_1453
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PT7_1453
Enzymes [BR:put01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PT7_1453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AEC19993
UniProt: F4GVG9
Position
complement(1577095..1578153)
Genome map
AA seq 352 aa AA seqDB search
MTDSTTRKSLPPGPVMVDVEGTVLTHHERERLRNPLVGGVILFARNFDHREQLAALCQAI
HAERNEPLLIAVDHEGGRVQRFRTDGFTSIPAMSVFGELWSQDSLAAMRLASEAGYVLGA
ELRACGVDLSFTPVLDLDYGVSQVIGNRSFHRDPRVVAMLARALIQGLMLSGMASCGKHF
PGHGAVEADSHHEIPVDQRSFEQIMQEDAAPYGWLGDMVLPSVMPAHVIYPQVDPQPAGF
SRHWIQKVLRQDLAYDGVVFSDDLTMEGATVAGDILARAEAALGAGCDMVLVCNRPDLAD
DLLSRLRIEHGAASVQRIRRLMPASAAPDWDALQADERYQYARRLQSQIVSG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagcactacgcgcaagagcctgccgcccggcccggtgatggtggatgtggaa
ggtacggtactgactcaccatgagcgtgagcgcctgcgcaatccactggtgggcggcgtt
attctgtttgcacgtaattttgatcaccgtgaacagcttgcggccctgtgccaggccatt
catgccgaacgcaatgagccgctgttgatcgccgtcgatcacgaaggcggccgcgtacaa
cgttttcgcactgatggctttacgtccattccggccatgagcgtcttcggcgagctttgg
tcgcaagactcgctggctgcgatgcggctggcgtctgaagcaggttatgtgcttggggcc
gagttgcgtgcgtgtggggtagaccttagcttcaccccggtgctggatctggactatggt
gtcagtcaggtcattggcaaccgctccttccatcgtgatccacgggtggtcgccatgctg
gccagggccttgatacaaggcttgatgctgtcgggtatggcgtcttgcggcaagcacttt
ccgggccatggggcggtcgaggccgattctcatcacgagattccggtcgaccagcgcagt
ttcgaacagatcatgcaggaagatgcggcgccttatggctggctgggcgatatggtattg
ccttcggtgatgccggcgcatgtcatttacccgcaggtggatccgcagccggctggcttt
tcgcgccactggatacaaaaagtcttgcgccaggacctggcttacgacggcgtggtgttt
tccgatgacctgacgatggaaggcgctaccgtggcgggcgatatcctggcccgggccgag
gctgccctgggtgcagggtgcgacatggtgctggtatgcaaccggcctgatctggccgac
gatctgctgtcacgccttcgcatcgagcatggcgcagcttcggttcagcgcatacgccgc
ctgatgcccgccagcgccgcgccggactgggatgctttgcaggctgatgaacggtatcaa
tatgccagaagacttcaatctcaaatcgtttctggctga

DBGET integrated database retrieval system