KEGG   Pusillimonas sp. T7-7: PT7_1711Help
Entry
PT7_1711          CDS       T01486                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00260  Glycine, serine and threonine metabolism
put00400  Phenylalanine, tyrosine and tryptophan biosynthesis
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01130  Biosynthesis of antibiotics
put01230  Biosynthesis of amino acids
Module
put_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PT7_1711
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PT7_1711
Enzymes [BR:put01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PT7_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA IMPDH Dus
Motif
Other DBs
NCBI-ProteinID: AEC20251
UniProt: F4GXK3
Position
complement(1828514..1829362)
Genome map
AA seq 282 aa AA seqDB search
MTASNERLKAAFAKKPGRTALIPYITAGDPSLAATPRLMHALVKAGADVIELGVPFSDPM
ADGPVIQRAAERAIKRGVGLRQVFDMVAQFRQTDMTTPVVLMGYANPIERMGQGAFAQFA
AKAGVDGVLVVDYPPEEIADFAVQLGAAGIDPIFLLAPTSTEARIQKVAQVARGYVYYVS
LKGVTGAGHIDTEDVAARVEAIRRHVSVPVGVGFGIRDADSAKRLAECADAVVIGSKLIQ
TMEDAVAAASAAGREANDIDEAAISAAANWLSGIRDALPEGR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgactgcttcgaacgaacggctcaaggccgcgtttgcaaaaaaaccaggacgcactgcg
ctgattccctacattactgcgggtgatccatcgcttgccgctacgcctcgcctgatgcat
gccctggtcaaggcgggcgccgatgtcatcgagctcggtgttcctttttccgatcccatg
gccgatggccccgtcatacagcgggcggctgaacgcgcaatcaagcgtggcgtgggcttg
cgccaggtgtttgacatggtggcgcaattcaggcaaaccgacatgaccacgcccgtggtg
cttatgggttatgcaaacccgatcgaaagaatggggcagggtgcatttgcgcagtttgcc
gccaaggctggcgtcgatggcgtcttggtggttgattatccgcccgaggaaatagccgat
tttgccgtacaactgggtgctgctggcatagaccctatttttctgctggcacctacttcc
accgaagcgcgcatacaaaaagttgctcaggttgcacgcggctacgtttattatgtttct
cttaagggcgttactggcgcgggtcatattgacaccgaagatgttgccgctcgcgttgag
gccatccgccggcatgtgtcggtaccggttggcgtgggttttggtatacgcgatgccgac
agcgccaaacggctggcagagtgcgccgatgcggtcgtcatcggcagcaagctgatccag
acgatggaagatgccgtggctgccgcttcggccgccgggagggaagccaacgatatcgac
gaggcagcgatatctgcggcggcaaactggttgagcggtatacgtgacgccttgccagaa
gggcgttaa

DBGET integrated database retrieval system