KEGG   Pusillimonas sp. T7-7: PT7_2341Help
Entry
PT7_2341          CDS       T01486                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
put  Pusillimonas sp. T7-7
Brite
KEGG Orthology (KO) [BR:put00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:put02044]
    PT7_2341
Secretion system [BR:put02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PT7_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: AEC20881
UniProt: F4GSF0
Position
complement(2502121..2502639)
Genome map
AA seq 172 aa AA seqDB search
MPKEGSVAPKERVNIVYKPATGDAQEQVELPLKQLVIGDFTQKESDTPVDERKPIQVDKD
NFNDVLKGQGLGLTMAVPNRLSDKPVEDEQIPVTLKFENIRDFEPDSIVEQVPELRQLVE
LREALKALKGPLGNLPEFRKKLQALIQDEGARERLLGELGVQDATPDAQDKE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagaaggatctgtagccccgaaagagcgtgtcaatattgtttataagccggcc
acgggcgacgcccaggagcaggtggagttgccgctcaagcagctggtcattggcgacttt
acgcagaaagagtctgatacaccggtcgacgagcgcaagcccatacaggtggacaaggac
aatttcaatgatgtgctcaaggggcagggcttgggcctgaccatggccgtccctaatcgt
ttgtcggataagcctgtcgaggacgagcagattccagtcacgctcaagttcgaaaatatc
cgtgacttcgagcctgattccattgtggagcaggtgccggagctgcgtcagttggtcgag
ctgcgtgaagcgctcaaggccttgaaggggccgctgggcaatctgcccgagtttcgtaaa
aaacttcaggccctgattcaagatgagggcgcacgtgagcgcctgttgggtgaactgggc
gtgcaagatgccacccctgacgctcaagacaaggagtaa

DBGET integrated database retrieval system