KEGG   Pusillimonas sp. T7-7: PT7_2369Help
Entry
PT7_2369          CDS       T01486                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00051  Fructose and mannose metabolism
put01100  Metabolic pathways
put01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:put00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PT7_2369
Enzymes [BR:put01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PT7_2369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AEC20909
UniProt: F4GSY6
Position
complement(2535083..2535865)
Genome map
AA seq 260 aa AA seqDB search
MSNTMEMSKDELIKRAQAQMQTQLKVTDWSTREKLAITCRVLFDGGHDSGLAGQITARGE
KPGTYYTQSLGLGFDEISVSNFLLVDEDLQVLEGQGMPNPANRFHSWVYRTRPDVQCIVH
THPLHVAALSMLEVPLAVSHMDNCTLYDDCAFLPDWPGVPVGNEEGELISKALGDKRAIL
LAHHGMLVAASSIEEACVLSLQFERTARMQLLAMAAGDIKPIKPELGREAHDWILRPRRS
QIGFEYYARRALRRYPDVLA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatacgatggaaatgtccaaggacgagttgattaaacgggcgcaagcccaaatg
caaactcaattgaaggtcactgattggtctacccgtgagaagctggcgattacgtgccgg
gtattgttcgatggcgggcatgattccgggctcgcgggccagattaccgcccgtggcgag
aaaccgggtacttactatacccaaagcctgggcctgggcttcgatgaaatcagtgtttcc
aacttcttgctggtagacgaagacctgcaagtgcttgaggggcagggcatgccgaatccg
gcgaaccggtttcactcctgggtctatcggacgcggcccgatgtgcaatgcatcgtgcat
acccatcccctgcatgtggcggcgctgtccatgctcgaagtgccgcttgctgtatcgcat
atggacaactgcactttgtacgacgattgcgccttcctgcccgattggcctggcgtgccg
gtcggtaatgaagagggggaactgatctcgaaggcactgggtgacaagcgcgctattttg
ctggcccatcacggcatgctggtggctgcctcgtccatcgaagaggcatgtgttctgtcg
ctacagttcgagcgtacggcgcggatgcagctgttggccatggcggctggcgatatcaag
cctatcaagcccgagttgggccgcgaggcgcacgactggatactcaggcctcgtcgttcg
caaatcggctttgaatactatgcgcgtcgtgcattgagacgctatccggatgtgctggct
taa

DBGET integrated database retrieval system