KEGG   Pusillimonas sp. T7-7: PT7_2482Help
Entry
PT7_2482          CDS       T01486                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
put  Pusillimonas sp. T7-7
Pathway
put00020  Citrate cycle (TCA cycle)
put00190  Oxidative phosphorylation
put00650  Butanoate metabolism
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01120  Microbial metabolism in diverse environments
put01130  Biosynthesis of antibiotics
put01200  Carbon metabolism
Module
put_M00009  Citrate cycle (TCA cycle, Krebs cycle)
put_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
put_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PT7_2482
   00650 Butanoate metabolism
    PT7_2482
  Energy metabolism
   00190 Oxidative phosphorylation
    PT7_2482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEC21022
UniProt: F4GTQ8
Position
2644747..2645160
Genome map
AA seq 137 aa AA seqDB search
MSAYPGQDSLRTPLKVARRLGSSKSGVHHWWLQRLTAIALIPLSIWLLYFMGALMHASYP
TVLAAIAQPVHAIFLIVLSLCLFWHGALGLQVIIEDYVHTRWLEVALQIALRFGAILATL
ACVLAVLAIWLGIAPQR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctatccggggcaagattcgcttcgcacgccgcttaaggtcgcacgcagactc
ggttcttccaagtcgggcgtgcatcattggtggctgcaacggctcaccgccatcgcgctg
attccactgtcgatctggcttctgtatttcatgggagctttgatgcacgcgagttacccg
accgtattggccgcaatcgcacagccggtgcacgcgatctttttgatcgtgctgagcttg
tgtctgttctggcatggcgcgcttggccttcaagtcattatcgaagactacgtacacaca
cgctggctggaggtcgcgctgcagatcgctttgcgttttggtgcgatcctcgccacgctg
gcctgtgtacttgcagtattggcgatctggctgggcatcgccccacagcgataa

DBGET integrated database retrieval system