KEGG   Pusillimonas sp. T7-7: PT7_2530Help
Entry
PT7_2530          CDS       T01486                                 

Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
put  Pusillimonas sp. T7-7
Brite
KEGG Orthology (KO) [BR:put00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PT7_2530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AEC21070
UniProt: F4GUA1
Position
complement(2691422..2691796)
Genome map
AA seq 124 aa AA seqDB search
MKPYDIAVTVAPQYLPDQSEPQEQQFVFAYTVRITNNGQHAAQVISRHWIITDGNQHVQE
VRGLGVVGQQPLLKPGETFEYTSGCPLPTPVGSMRGSYLCVGENGVPFDVAIHEFVLAMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatacgacatcgcggttaccgtggcgccacagtatttgcctgatcaatccgag
ccccaagagcaacagttcgtctttgcctatacagtacgcattaccaataatgggcagcat
gctgcccaggtcatcagccggcactggatcatcactgatgggaatcagcatgtccaggag
gtgcgtgggctgggcgtggttggccagcagcccttgctgaaaccgggcgaaaccttcgaa
tacaccagcggttgtccgctgcccacacctgtgggttccatgcgtggcagctatctgtgc
gtgggggaaaatggcgtgcccttcgatgtggccatccatgagtttgttctggccatgccg
cgtaccttgcactaa

DBGET integrated database retrieval system