KEGG   Pusillimonas sp. T7-7: PT7_2729Help
Entry
PT7_2729          CDS       T01486                                 

Definition
(GenBank) haloacetate dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00361  Chlorocyclohexane and chlorobenzene degradation
put00625  Chloroalkane and chloroalkene degradation
put01100  Metabolic pathways
put01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:put00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PT7_2729
   00361 Chlorocyclohexane and chlorobenzene degradation
    PT7_2729
Enzymes [BR:put01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PT7_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 Hydrolase_like Put_Phosphatase HAD
Motif
Other DBs
NCBI-ProteinID: AEC21269
UniProt: F4GVR3
Position
complement(2889121..2889807)
Genome map
AA seq 228 aa AA seqDB search
MPDTQAIVFDLYGTLYDVHSVVQQCDAAYPGRGVDISTMWRQKQLEYTWLRSLMGQYISF
EQATHDALVYTCNHLRLDLDETTCTVLCNAYLDLSPYPEVPAALQRLKDMGLPLAILSNG
SAFSIDSVVKNSGLQEYFSHLLSVEPVRVFKPDPRVYMLACQALDLPPPRILFVSSNAWD
ASGARHFGFDVCWVNRRDNTFDELGMAPSYVLRGLDEVPGIVSTENWQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccggatacacaggctattgtttttgatctttacggcacgctgtacgacgtccattcg
gtcgttcaacagtgtgatgctgcgtatcccggccgaggtgttgatatcagcaccatgtgg
cggcagaagcagctcgaatacacctggctgcgcagcttgatggggcaatacatttcgttc
gagcaagcgacccatgacgcgctcgtctatacctgcaatcacctgaggctagatctcgac
gagacaacttgcactgtgttgtgcaatgcttatctggacctgtcgccgtacccagaggta
cccgctgcattgcagcgattgaaagacatgggattgccgctggccatcttgtctaatggg
tcggctttctcgattgacagtgttgtgaaaaattctggcttgcaagaatatttctctcac
ctgctcagtgttgagcccgttcgagtattcaagcccgatccgcgcgtctatatgctcgct
tgccaagcgttggacctaccgccgccccgaattctctttgtctcgtcgaacgcatgggat
gcgtcgggagcacgccatttcggatttgacgtttgctgggttaaccgtcgcgacaatacg
tttgacgaattgggcatggcgccatcatatgtgcttcgagggttggatgaagtacctgga
atcgtgagcacggagaactggcaatga

DBGET integrated database retrieval system