KEGG   Pusillimonas sp. T7-7: PT7_3027Help
Entry
PT7_3027          CDS       T01486                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00071  Fatty acid degradation
put00072  Synthesis and degradation of ketone bodies
put00280  Valine, leucine and isoleucine degradation
put00310  Lysine degradation
put00362  Benzoate degradation
put00380  Tryptophan metabolism
put00620  Pyruvate metabolism
put00630  Glyoxylate and dicarboxylate metabolism
put00640  Propanoate metabolism
put00650  Butanoate metabolism
put00900  Terpenoid backbone biosynthesis
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01120  Microbial metabolism in diverse environments
put01130  Biosynthesis of antibiotics
put01200  Carbon metabolism
put01212  Fatty acid metabolism
put02020  Two-component system
Brite
KEGG Orthology (KO) [BR:put00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PT7_3027
   00630 Glyoxylate and dicarboxylate metabolism
    PT7_3027
   00640 Propanoate metabolism
    PT7_3027
   00650 Butanoate metabolism
    PT7_3027
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PT7_3027
   00072 Synthesis and degradation of ketone bodies
    PT7_3027
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PT7_3027
   00310 Lysine degradation
    PT7_3027
   00380 Tryptophan metabolism
    PT7_3027
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PT7_3027
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PT7_3027
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PT7_3027
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:put04147]
    PT7_3027
Enzymes [BR:put01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PT7_3027
Exosome [BR:put04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PT7_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: AEC21567
UniProt: F4GMU4
Position
complement(3199119..3200300)
Genome map
AA seq 393 aa AA seqDB search
MSDPIVIVSVARTPMGGMMGSLSGLAAHQLGATVIKAAIERAGIQGEAVDEVIMGNVLQA
GQGQAPARQAALGAGLPLGVGCTTIHKVCGSGLKAAMFGHDILLAGSADVVVAGGQESMS
NAPYLLLRGRQGYRYGHSTVYDHMALDGLEDAYQRGTAMGVFAEDCAAKYTFTREQQDAF
SLESLRRARAATEDGSFKWEITPVTVAGRKGDTVIDTDEAPAKAMPEKIPTLKPAFKKDG
TVTAANSSSISDGAAAMVLMRESMAKKLGATPLARIVSHTQHSQEPGWFTTAPVGAINKL
LTKNGWTADDVDLYEINEAFAVVTMAAMVELKLPHEKVNIHGGATALGHPIGASGARLLT
TLVGALRKTGGKRGVASLCIGGGEAVALAIEMV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcctattgttatcgtgtctgtcgcacgcacgcccatgggcggcatgatgggc
agcttatcgggcctggccgcacaccagctgggcgccacagtcatcaaggccgccatcgaa
cgcgccggcatccagggtgaagccgtcgatgaagtcatcatgggcaatgtgctgcaagcc
ggccagggccaggctccggcacgccaggcggcgttgggcgcaggcctgcccttgggtgta
ggctgcaccaccatacacaaggtgtgcgggtccggcctgaaagcggccatgttcggccac
gacattctgcttgcaggcagcgccgacgtggtcgttgcaggcggccaggaaagcatgagc
aacgccccttacctgctgctgcgcgggcgccagggataccgctatggtcattccaccgtc
tacgaccacatggcgctggatggcctggaagacgcctatcagcgcggcaccgccatgggc
gtcttcgccgaagactgcgccgcaaaatacacctttacccgtgaacagcaagacgcgttc
tcgctcgaatccctgcgccgtgcacgcgcggccactgaagacggcagcttcaaatgggaa
atcactcccgttaccgtggccggccgcaagggcgacaccgtcatcgacaccgacgaggcc
ccggccaaggccatgccggaaaaaatccccacactgaaacccgccttcaagaaagacgga
acggtcacggcagccaactcttcatcgatatcagacggcgccgcagccatggtgctgatg
cgcgaatcaatggccaagaagctgggtgcaacacccctggcccgcatcgtcagccacacc
caacactcgcaagagcccggctggttcaccacggcgcccgtgggcgccatcaacaagctg
ctcacaaaaaacggctggacggccgacgacgtagacttgtatgaaatcaacgaggcgttt
gccgtcgtcaccatggccgccatggtcgagctgaagctgccccatgaaaaggtcaacatc
cacggcggcgccaccgcactgggccaccccatcggcgcctcgggcgcgcgtctgcttacg
acactggtcggcgcactacgcaagactggcggcaagcgcggtgttgcttcgctgtgcata
ggtggcggcgaagctgtggcactggccatcgaaatggtctaa

DBGET integrated database retrieval system