KEGG   Parachlamydia acanthamoebae: PUV_06950Help
Entry
PUV_06950         CDS       T01552                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
puv  Parachlamydia acanthamoebae
Pathway
puv00010  Glycolysis / Gluconeogenesis
puv00260  Glycine, serine and threonine metabolism
puv00680  Methane metabolism
puv01100  Metabolic pathways
puv01110  Biosynthesis of secondary metabolites
puv01120  Microbial metabolism in diverse environments
puv01130  Biosynthesis of antibiotics
puv01200  Carbon metabolism
puv01230  Biosynthesis of amino acids
Module
puv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:puv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PUV_06950 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PUV_06950 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PUV_06950 (gpmA)
Enzymes [BR:puv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PUV_06950 (gpmA)
Membrane trafficking [BR:puv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PUV_06950 (gpmA)
Exosome [BR:puv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PUV_06950 (gpmA)
  Exosomal proteins of melanoma cells
   PUV_06950 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCB85645
UniProt: F8KXR5
Position
756893..757663
Genome map
AA seq 256 aa AA seqDB search
MSFDICRSRARLPLARLVFSRYPKKIKEEKAMNKLILMRHGQSEWNRLNLFTGWVDIPLS
PLGIEEALVGGDRIKDIPIDIIYTTSLMRAQMTAMLAMSRHTSGKTPVILHPGQGKLQEW
GKIYSKTAEESCIPVICAWELNERMYGELQGLNKAETAEKFGADQVKIWRRSFDVPPPNG
ESLEMTAARSIPYFEENILPQLQEGKNVFVSAHGNSLRSIIMYLDQLSREEVLNLELATG
EPIFYMFQDGKVIRES
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgatatttgtcgatcgagggccagattaccgcttgctcgtttagttttttca
cgctatcctaaaaagatcaaagaggagaaagctatgaataagctcattttaatgcgccat
ggacaatcggaatggaaccgtctgaatctctttactggctgggtagatatccctctttca
cctcttggtattgaagaagctttggtggggggagatcgaattaaagacatcccgattgat
atcatttatacaacatcactcatgcgtgcgcaaatgactgctatgcttgccatgagtcgc
catacatcgggaaaaactcccgtgattcttcatcctgggcaaggaaaactccaagagtgg
ggaaagatctatagtaagactgcagaagagtcgtgtattccagtgatatgtgcttgggaa
ctaaatgagcgaatgtatggcgaactgcaaggattaaataaagctgaaactgccgaaaaa
tttggagctgatcaagtaaaaatatggcgtagaagttttgatgttccgcctccaaacggg
gaaagtttggagatgacagctgcgcgttcaattccttattttgaagaaaatatccttcct
cagctacaagaaggcaaaaatgtttttgtgtctgcgcatggaaattccttacgttcgatc
atcatgtacttagatcagttgtcgcgggaagaagtattaaatcttgaattagccactgga
gagcctattttctatatgttccaagatggtaaagtaatcagagagtcttaa

DBGET integrated database retrieval system