KEGG   Pantoea vagans C9-1: Pvag_0162Help
Entry
Pvag_0162         CDS       T01326                                 

Gene name
pdxa3
Definition
(GenBank) PdxA-like protein
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
pva  Pantoea vagans C9-1
Brite
KEGG Orthology (KO) [BR:pva00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pvag_0162 (pdxa3)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     Pvag_0162 (pdxa3)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     Pvag_0162 (pdxa3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ADO08382
UniProt: E1SDT7
Position
181943..182923
Genome map
AA seq 326 aa AA seqDB search
MSKIIAITMGDPAGISPEIIIKALSEGELNGIPAVVIGCASTLRRIMAMNITPQAELRVL
DRVQDARFAPGIINVIDEPLADPDALKPGVVQKEAGDLAWRCVKRATELALAGEVHAIAT
APLNKEAMHAAGHLYPGHTELLAHLTDTKDYAMVLYTDKLKVIHVTTHIALRKFLDTLNQ
TRIKTVIGMADTFLRRVGYSAPRIAVAGVNPHAGENGLFGDEEITTVAPAIEAMKAQGID
VSGPCPPDTVFLQCQDGRYDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHGT
AFDIAWTGKAKSDSMAISIKLAMQLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaattattgcgatcaccatgggcgatccggcgggcatcagcccggaaatcatc
atcaaagcgctctctgaaggtgagctgaatggcattcctgccgtggtgattggctgtgcc
agtacgctgcgccgcattatggcgatgaacatcaccccgcaggctgagctgcgggtgctg
gatcgggtacaggatgcacggtttgcgcccggcattatcaatgtgatcgatgagccgctg
gccgatccggacgcgctgaaacctggcgtggtacagaaagaggccggggatctggcgtgg
cgctgcgtgaagcgggccaccgaactggcgctggccggtgaggtgcatgccattgctacc
gcgccgctgaataaagaggcgatgcatgcggcgggccatctctatccggggcacaccgaa
ctgctggcgcacctgactgacaccaaagattacgctatggtgctctataccgataagctg
aaagtcattcatgtcacaacccatattgcgctgcgtaagttcctcgacacgctcaaccag
acacgcattaaaaccgtgattggtatggcggacaccttcctgcgtcgtgtcggctacagc
gccccgcgtatcgccgtcgcgggtgttaatccgcacgctggtgagaacgggctgtttggc
gacgaggagatcaccaccgttgcccccgcgattgaggcgatgaaagcgcaggggattgat
gtctccgggccttgcccgccggacacggtgtttctgcagtgccaggatggacgctatgac
atggtggtggcgatgtaccatgatcaggggcacatcccgcttaaactgctgggcttctat
gatggcgtgaacattaccgcaggcctgccgtttatccgcacctctgctgaccacggcacg
gcatttgatatcgcctggacaggtaaagcgaagtctgacagcatggcgatctcgattaaa
ctcgcgatgcagctcgcatag

DBGET integrated database retrieval system