KEGG   Pantoea vagans C9-1: Pvag_0551Help
Entry
Pvag_0551         CDS       T01326                                 

Gene name
sucD
Definition
(GenBank) Succinyl-CoA synthetase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00020  Citrate cycle (TCA cycle)
pva00640  Propanoate metabolism
pva00660  C5-Branched dibasic acid metabolism
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
pva01130  Biosynthesis of antibiotics
pva01200  Carbon metabolism
Module
pva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pvag_0551 (sucD)
   00640 Propanoate metabolism
    Pvag_0551 (sucD)
   00660 C5-Branched dibasic acid metabolism
    Pvag_0551 (sucD)
Enzymes [BR:pva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pvag_0551 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Lysine_decarbox
Motif
Other DBs
NCBI-ProteinID: ADO08756
UniProt: E1SH15
Position
577198..578073
Genome map
AA seq 291 aa AA seqDB search
MSILIDKNTKVICQGFTGGQGTFHSEQALAYGTQLVGGVTPGKGGTTHLGLPVFNTVREA
VEATGATATVIYVPAPFCKDGILEAIEAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIMPGHIHQPGRVGIVSRSGTLTYEAVKQTTDIGYGQSTCVGIGG
DPIPGSNFIDILKMFQDDPQTEAIVMIGEIGGSAEEEAAAFIKEHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGDAVKAVLPAK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtccattctgatcgacaaaaacaccaaagtcatttgccagggtttcaccggtggccag
gggactttccattctgagcaggcgctggcttacggtactcagctggttggcggcgtgacg
ccaggcaaaggcggcacgacgcatctcggcctgccggtgttcaacaccgtacgcgaagcg
gtagaagcgaccggcgcaactgccaccgtgatctacgttccggcacctttctgtaaagat
ggcatcctggaagcgatcgaagcgggcatcaagctgatcatcaccatcaccgaaggtatc
ccgacgctggatatgctgactgtgaaagtgaagctggatgaagcgggcgtgcggatgatc
ggtccaaactgtccgggcgtaatcaccccaggtgaatgtaagatcggcatcatgccaggc
cacattcaccagccgggccgtgtcggtatcgtatcccgttcaggcaccctgacctatgaa
gcagttaagcagaccactgacatcggctacggccagtcaacctgcgtcggcatcggtggt
gacccgatccctggctctaacttcatcgacatcctgaaaatgttccaggatgatccacag
actgaagcgatcgtgatgatcggtgaaatcggtggcagcgcagaagaagaagccgcagcc
ttcatcaaagagcacgtgaccaagccggttgtaggctacattgctggcgtcaccgcgccg
aaaggcaagcgcatgggccatgcgggcgccatcattgccggtggtaaaggtacagcagat
gagaaatttgctgcactggaagccgcaggcgtgaaaaccgttcgcagcctggctgacatc
ggtgacgcagttaaagccgtattaccggcaaaataa

DBGET integrated database retrieval system