KEGG   Pantoea vagans C9-1: Pvag_0795Help
Entry
Pvag_0795         CDS       T01326                                 

Gene name
agp
Definition
(GenBank) glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00010  Glycolysis / Gluconeogenesis
pva01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_0795 (agp)
Enzymes [BR:pva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Pvag_0795 (agp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 HC2
Motif
Other DBs
NCBI-ProteinID: ADO08995
UniProt: E1SIZ3
Position
840379..842115
Genome map
AA seq 578 aa AA seqDB search
MNGIGTMIKKLSLCALSVLAALPVGTVAFAADGDMQLQQVLMLSRHNLRAPLADNGSVLE
QSTKKSWPQWDVPGGQLTTKGGVLEVYMGNYTRQWLAQQGLVKNGSCPDSNNVFVYANSL
QRTVATAQFFVNGAFPGCDVAVTHQDEMGAMDPVFNPVITDDSEAFNKKALAAMAAANEK
LSLKPAFQRLEKIVDYKASPACNNKKQCDLSSGQNTFSAENGKEPTVSGPLKVGNSLMDA
FTLQYYEGFPLDQVAWGQIKTPEQWKELSAIKNGYQDTLFTSPDVSREVAAPLVDYIRSQ
LVDQDKANAPKITLMVGHDSNIASLLSALQVKPYELPDTYEKTPIGGQVVFERWHDAKND
KDLLKVEYVYQTADQLRNADVLSLKNPPKRVTLQLAGCEADANGYCSWDQFSQVLNAALQ
GTPMQPAAAPQPAAQADDDSAKAAATQDAAADKAEADKATAAKEKSDADKAAAEKSEADK
AAAEKAKADKAAADKAAAEKAKAEKAKADKAAADKAAAEKAKADKAAAEEKAAAEKAKAD
NAAESASDNKATTDKADAANAPATAHNDNSTSAAVATQ
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaataggcacaatgatcaagaaactgagtctttgcgcattgtcagtgctcgct
gcattgccggtcggaacggtagcatttgctgctgatggcgatatgcagctgcaacaggtg
ctgatgttaagccgtcacaatctgcgtgcgccgctggccgataatggcagcgtgctggag
cagtcgaccaaaaagagctggccgcagtgggatgttcccggcggacagctgaccaccaaa
ggtggcgtgctggaagtctacatgggtaactacacccgtcagtggctggcacagcagggc
ctggtgaagaacggcagctgccctgacagcaataacgtctttgtttacgcgaacagcctg
cagcgcactgtcgctaccgcgcagttcttcgtgaatggtgccttccctggctgtgacgtt
gccgtcacgcatcaggatgaaatgggcgccatggatcccgtattcaatcccgtcatcacc
gatgacagtgaagccttcaataaaaaagcgctggccgccatggccgccgccaatgagaaa
ctgtcactgaagcccgccttccagcggctggaaaagattgtcgactacaaagcttcgcct
gcctgtaacaataaaaagcagtgcgacctcagcagtggtcagaacaccttcagcgctgaa
aacggtaaagagccaacggtcagtggcccgctgaaagtgggtaattcgctgatggatgcc
tttacgctgcaatattacgaaggtttcccgctggaccaggttgcctggggccagatcaaa
acgcctgaacagtggaaagagctgtcagcgattaaaaatggttatcaggacacgctgttt
accagtccggacgtttcccgtgaagtggcagcaccgctggtggattacatccgcagtcag
ttagtggatcaggacaaagccaacgcgccgaaaattacgctgatggtcggccatgactcg
aacatcgcctcgctgctgagtgcgttacaggtcaagccttatgagctgcctgacacctat
gaaaaaacgccaattggcggtcaggttgttttcgaacgctggcatgatgcgaaaaacgat
aaagacctgctcaaggtggagtatgtttatcagaccgccgatcagctgcgcaatgcggat
gtactgagcctgaagaacccaccgaagcgcgtgacgctgcagctggcgggttgcgaggcc
gatgcgaatggctattgcagctgggatcagttctctcaggtgctgaatgcggcactgcag
ggtacaccgatgcagcctgctgcggcaccacaaccggcagctcaggctgacgatgacagt
gcgaaagccgccgcgacgcaggatgctgcagccgataaagctgaagcggacaaagcgacc
gcagccaaagagaaatctgacgcagataaagctgctgctgagaagtcagaggcggacaaa
gccgcagctgaaaaagcgaaagcggacaaagccgcagccgataaagctgctgcagaaaaa
gcaaaagcagaaaaggcaaaagcggataaggctgcagctgataaagccgcggctgaaaag
gcaaaagctgacaaagcagcagcagaagaaaaagccgccgctgagaaagcaaaagccgac
aatgcagcagaatcagccagtgacaataaagccacgactgacaaagctgacgccgcgaat
gcgcctgcaacggcacacaatgacaattcaacgtcagcagctgtggccacacagtaa

DBGET integrated database retrieval system