KEGG   Pantoea vagans C9-1: Pvag_1022Help
Entry
Pvag_1022         CDS       T01326                                 

Definition
(GenBank) Putative type VI secretion system, core protein
  KO
K11906  type VI secretion system protein VasD
Organism
pva  Pantoea vagans C9-1
Pathway
pva03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pvag_1022
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1022
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: ADO09215
UniProt: E1SAE0
Position
1073370..1073867
Genome map
AA seq 165 aa AA seqDB search
MMRTTQLRGGLIVLLMWLLTACSSSSTPPVAYYNLDVQGQNQLNGGAPLKVRVVLLSSDA
EFMSADFFSLQNQSATVLGSAQLNTQQFFLTPEQRSKTLRIKSLPEARFIGIMAEYQALD
GKVWRLSLPVPEGESPSFWAFWKRDDSELNARIVAGINGLHVEKQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaacaacacaactgcgcggtgggctgatcgtgctgctgatgtggctgctgacg
gcctgcagcagtagcagtacgccgccggtggcttactataacctggacgttcaggggcag
aatcagcttaacggcggtgcgccgctgaaggtccgtgtggtgttactaagctccgatgcg
gagttcatgtcagcagacttcttctccctgcaaaaccagtccgcaacggtgctgggcagt
gcgcagcttaacacccagcaattcttcctgacgccagagcagcgcagcaaaacgctgcgg
attaagagcctgcctgaggcgcgcttcatcggcatcatggcggaatatcaggcgctggat
ggcaaggtgtggcgactgtcgctgccggttcccgaaggggagtcaccctcattctgggca
ttctggaaacgtgacgatagcgagctgaatgcgcgcatcgtggcgggaattaatggcctt
cacgtggaaaaacagtga

DBGET integrated database retrieval system