KEGG   Pantoea vagans C9-1: Pvag_1023Help
Entry
Pvag_1023         CDS       T01326                                 

Definition
(GenBank) Putative type VI secretion system, core protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
pva  Pantoea vagans C9-1
Brite
KEGG Orthology (KO) [BR:pva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1023
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ADO09216
UniProt: E1SAE1
Position
1073873..1075213
Genome map
AA seq 446 aa AA seqDB search
MNRAEKVVWTEGMFLRPHHFQQSENYLLSTLREWGQSQRVYTWGFYDLEFDEALLRQGKL
ALSAASGCLPDGTFFAFSQPQHGPAPLDLPASVDRSKVVLAIPTRRNGREAVAFQESQDS
LARYLAWEAEVEDDNAQAVGSATVQFGKLRLRLMLEQDLTAEWTAMGVAQVIEKRSDNHI
RLDSDYIPPMLTLNSSRPLQNMFNDLHGLIQQRSQQLSQRAPGTGRFNSADMVDFMLLAL
LNRQLGLHSHLQHLPLLHPETLYSHWLQLAAELSTWTPARAPEGLPLYDHDDLHNCFSRL
SLLLRQGLSQVMEESAIQLPLTQRSHGLNVATVPESSMVHEFGFVLAVKASVPADTLKTH
FPAQMKVAPVSKIRDLVQLQLPGLALRAMPGAPPQIPWHAGYSYFELDKNSELWKEMERS
GAFALHLAGEFPGLNMEFWAIRSQSE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagccgaaaaggtcgtctggaccgaggggatgtttctgcgtcctcaccatttc
cagcagtcagaaaattatcttctcagcaccctgcgtgaatggggtcagtcacagcgcgtt
tacacctggggcttttacgatctggagtttgatgaagcgctgctgcgtcaggggaaactg
gcgctgagtgcggccagcggctgtctgccagacggcacgtttttcgccttcagccagccg
caacatggcccggcaccgcttgatctgccagcttctgttgaccgcagcaaagtggtgctg
gcgataccgacccgtcgcaatggccgcgaagccgtcgctttccaggagtcgcaggattct
ctggcgcgctatctggcctgggaagcggaagtggaagatgacaacgcccaggccgtaggc
agcgcgacggtacagttcggcaagctgcgcctgcggctgatgctggagcaggatctgacc
gccgagtggaccgcgatgggcgttgcgcaggtgattgaaaaacgcagcgacaaccatatc
cggctcgacagcgattacatcccgccgatgctgactctgaacagcagccgtccgctgcaa
aacatgtttaacgacctgcacgggctgatccagcagcgcagccagcaactgagtcagcgt
gcacccggcaccggccgcttcaacagcgccgatatggtcgattttatgctgctggcgctg
ctcaatcgtcagcttggcctgcacagccatctgcaacatctgccgctgctgcatcctgaa
accctctacagccactggctgcaactggccgcagagctgagtacttggacgcccgcgcgc
gcgccggaaggactgccgctctacgatcatgatgacctgcataactgcttcagccgtctg
tcgctgctgctgcgtcagggtctgtcgcaggtgatggaggagagcgccattcagctgcca
ctgacgcagcgttcgcacggccttaacgtcgctaccgtgccggagagcagcatggtgcat
gagttcggctttgtgctggcggtgaaagccagcgtgccggccgacaccctgaaaacccat
ttcccggcacagatgaaagtcgcgccggtcagcaaaatccgcgatctggtgcagctgcag
ctgccgggtctggcacttcgggcgatgcccggcgcgccgccgcagatcccgtggcatgcc
ggatacagctatttcgaactggataagaacagcgagctatggaaagagatggagcgctcg
ggcgcttttgcgctgcatcttgccggtgagtttccgggcctgaacatggagttctgggcc
atccgcagtcagtcagaataa

DBGET integrated database retrieval system