KEGG   Pantoea vagans C9-1: Pvag_1024Help
Entry
Pvag_1024         CDS       T01326                                 

Definition
(GenBank) Putative type VI secretion system, core protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pva  Pantoea vagans C9-1
Pathway
pva03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pvag_1024
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1024
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA
Motif
Other DBs
NCBI-ProteinID: ADO09217
UniProt: E1SAE2
Position
1075231..1076469
Genome map
AA seq 412 aa AA seqDB search
MMQEQQHSHSDLAPDASHQNVLVAAANPLINAIPQIRHSVSHEDPAQLRQQLIDQIRRFE
LSCQQSGLGYEVIIGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFFQ
LLAKLSQNPRRHILMLELIYFCLLLGFEGRYRVLDNGRSQLETIKQRLLQMIKSVRGSYA
AALSPHPTDQPVLRKLWRPMIPLWACAAVAGLAACLFYIVLNWRLGDYTSPVLARIYQTA
LPEVKIGNPAPPPPATLNLRAFLKPEIDAGLVAVRDEADRSVVTLKGDGLFASAATEVRG
GYIDVIRRIAAAMNNVSGQIQVIGYSDNVPIRSARFASNFELSLARARSVQTLLQQQLAQ
PSRVKAEGRGESNPLVPNTSAENRARNRRVEITLLVAPDATHAELNGLARGN
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggaacaacaacattcacacagcgatcttgcgccggatgccagccaccagaat
gtgctggttgcggcggccaaccccctgattaacgcgattccacagatccgccattcggtg
tcgcatgaagacccggcgcaactgcgtcagcagctgatcgaccagatccgccgctttgag
ctgagctgtcagcagtcgggcctcggctacgaagtgatcatcggcgcgcgctactgtctc
tgtaccgcgctggatgaggcggcggcgctgacgccgtggggcagtcgcggcgtctggacc
agcaacggtctgctggtcacctttcataacgaaacctggggcggcgagaagtttttccag
ctgctggcgaagctgtcgcagaaccccagacgtcacattctgatgctggagctgatctac
ttctgcctgctgctggggttcgaaggacgctaccgggtgctggacaatggccgctcgcag
ctggagaccatcaaacagcgcctgctgcagatgatcaaaagcgtacgcggcagttacgcc
gcggcgctgtcaccgcatcccaccgatcagccggtgctgcgcaagctatggcggccgatg
atcccgctgtgggcctgtgcggccgtggctgggctggccgcctgtctgttctacatcgtg
ctcaactggcgtctgggtgattacacctcgccggtgctggcccgcatctatcagacggcg
ctgccggaagtgaagattggcaacccggcgccgcctccgcctgccacgctgaatctgcgc
gccttcctgaagccggaaattgatgccgggctggtggcggtgcgtgatgaagcggaccgc
agcgtggtgacgctgaaaggggatgggctatttgcttcggcggcgaccgaagtgcgcggc
ggctacattgacgtgatccggcgcatcgcggcggccatgaacaacgtcagcggccagatt
caggtgattggctacagcgataacgtgccgatccgcagcgcgcgcttcgcctccaacttt
gagctgtcgctggcgcgcgcccgttcggtgcagaccctgctgcaacagcagctggcgcag
ccgtcgcgggtgaaagcggaagggcgcggcgaaagcaatccgctggtgccgaacaccagc
gcagaaaatcgcgcgcgtaaccgtcgtgttgaaatcacactgctggtggcgccggatgcg
acgcatgccgaactcaacggtctggcgagagggaactga

DBGET integrated database retrieval system