KEGG   Pantoea vagans C9-1: Pvag_1025Help
Entry
Pvag_1025         CDS       T01326                                 

Definition
(GenBank) Putative type VI secretion system, core protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pva  Pantoea vagans C9-1
Pathway
pva03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pvag_1025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1025
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C Xpo1
Motif
Other DBs
NCBI-ProteinID: ADO09218
UniProt: E1SAE3
Position
1076473..1080102
Genome map
AA seq 1209 aa AA seqDB search
MLNILFAVLTSRLAWGFVGITALSFIIWVIGPVFSIVDSRPLEPEQNRMISIALLYLVWG
LGQAIPRLYNYWLNRKLMSSLETGKSDAPEADRQRLTSEEQVLAGRFSEATEMLRKAHFQ
RHSSKGTPFWAQRFGRQYLYQLPWYMIIGAPGAGKTTALVNSGLQFPLADKFGKSALRGI
GGTRNCDWWFTNDAVLLDTAGRYSTQESQQERDASEWHHFLDLLRKYRGRQPINGVIVTL
SVSDLLSQSPEALRNQALALRQRLMELHDRLGIRFPVYVLVTKADLLKGFRSYFASLDKA
QREQIWGFTFPWAKASAADFELNSQFQQEYSLLQQRLDAGLADRLLTESDAQARAESYLF
PQEFAALRPLLADALDTLFARSDFETQFAPRGIYFASGTQEGLPFDRVMGELNRALNLPG
QQAGESGSWDQVDKDAPIPQNKGQSFFLKGVLENVVFQESGLAGSNRWWELRNRAGLWSG
YLALLLLLLVAGGLWLTSYSKNKAYLQEMAAKAPQVEQLGDQLQKQVNGDLFALVPYLNT
LLHLPESADFSLESPPLTRRMGLYRGTEVSDATRALYDKALKQLLLPQVAQNITRWLRND
NGSDADYSYEALKAYQMLYQPKHYDGKFLQAWLMLNLSRELPQNVTQQQVKQLAWHLQQL
LETQIHSSPYAKDDALVKREQALINQMPLSQRVYGRLKRLLQRDDSLQPVTLAALGGPQS
ELVFSRKSGKSVNDGVAGLYTPDGYWQHVDKQIGPVTQALYQDDLWVLDGAAPQQKSEQT
DLAVRQLYVQDYIRQWEQFLSDIQLNSSADLSQRINTARLLSGNHSPLRQLVINLSNLLT
LNRAQPDEKTAQAAKPSDNSATRTLEALFTSPEAAAARGQAAAQASPEQAVAVHFAPVLE
LAQPLQQGSKVLAVDDFLHQIDDLYRYLTAVQDAANSGMPPPASDAISRLQASAGRLPGS
LQNMVSSMAVGASSDAQRRDMDNVRKRITMEVGSFCRQAIAGRYPLVRSARSEVTPDDLA
RMFAPGSGMMDSFFRDNLASKVDTTNASWRFTPGIDGKTLPGGEALLRPFQQAQSIRDAF
FANGATTPGFRVTLRTVKMDNDILNLTLDVDGQQLRYSHGPQAVQMVSWPGPGGTSQVRM
QLGLTNGTTSTLVTSGPWALNRFFDRARVTAAGGLTREATFSVEGHQVTLLFTPGSIRNP
FQLPGFSCP
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatattctgtttgcggtgctgaccagccgccttgcgtggggctttgtcggcatc
accgcgctctcttttatcatctgggtgattggcccggtcttctctatcgttgattcgcgg
ccacttgagccagagcagaaccgcatgatcagtatcgcgctgctctatctggtctgggga
ctggggcaggcgattccacggctctacaattactggcttaaccgcaagctgatgtcgagt
ctggaaaccggcaaaagcgatgcgccggaagccgatcgtcagcgtctgaccagtgaagag
caggtgctggcgggccgtttctccgaagctactgaaatgctgagaaaggcgcacttccag
cgccacagcagcaaaggcacgccgttctgggcgcagcgctttggtcggcagtatctctat
cagctgccgtggtacatgattatcggtgcacccggtgccggtaaaaccaccgcgctggtc
aactccggcctgcagttcccgctggcggataagtttggcaagtcggccctgcgcggcatt
ggcggcacccgcaactgcgactggtggtttactaatgacgccgtgctgctcgataccgcc
gggcgttacagcacccaggagagtcagcaggagcgggatgccagcgaatggcaccatttc
ctcgatctgctgcgtaaatatcgcggacgtcagccgatcaacggcgtcatcgtcaccctg
agcgtctccgatctgctgagtcagtcgcccgaggcactgcgcaaccaggcgctggcgctg
cgtcagcgtctgatggagttgcacgatcgtctcggcatccgtttcccggtttatgtgctg
gtcaccaaagcagacctgctcaaaggtttccgcagctacttcgcctcgctggataaagcg
cagcgtgaacagatctggggattcacctttccgtgggcgaaggcatccgccgccgatttc
gagctgaacagccagttccagcaggagtattccctgctgcaacagcggctcgatgccgga
ctggctgatcggctgctgacggagagcgacgcgcaggcgcgtgccgaaagctatctcttc
ccgcaggagttcgctgcgctgcgtccgttgctggccgacgcgctcgacacgctgttcgcc
cgctccgattttgaaacccagttcgcgccacgcggcatctactttgccagcggcacccag
gaaggtctgccgtttgaccgggtaatgggcgagctgaaccgtgccctgaatctgccaggc
cagcaggcgggcgaatcgggcagctgggatcaggtcgataaggacgccccgattccgcag
aacaaagggcagagtttcttcctcaaaggcgtgctggaaaatgtagttttccaggagtcg
ggtctggcgggcagcaaccgctggtgggagctgcgcaaccgcgccggactctggtcaggc
tatctggcgctgctgttgctgttactggtcgcgggcggtctgtggctcaccagctacagc
aagaacaaagcctatctgcaggagatggccgctaaagcgccgcaggtggagcaactaggc
gaccagcttcagaagcaggtcaacggcgatctctttgcgctggtgccttatctcaacacc
ctgttgcacctgccggaaagcgccgacttctcgctggaatcgccgccgctgacgcgtcgt
atgggcctttatcgtggcaccgaggtcagcgatgcgacgcgtgcgctttacgacaaagcg
ctgaagcagctgctgttgccgcaggtggcgcagaacatcacccgctggctgcgcaatgac
aacggcagcgatgcggattacagctatgaagcgcttaaggcctatcagatgctctatcag
ccgaagcactacgatggcaagttcctgcaggcgtggctgatgcttaacctgtcgcgcgag
ctgccgcagaacgtgacacagcagcaggtaaaacagctggcgtggcatctgcaacagctg
ctggagacgcagattcactcgtcgccatatgcgaaggatgacgcgctggtaaagcgcgag
caggcgctgattaatcagatgccgctgtcacagcgcgtctatggacgcctgaagcgcctg
ctgcaacgtgatgacagcctgcaaccggtgacgctggcggcgctgggcggtccccagagc
gagctggtgttttcccgtaaaagcggtaaatcggttaatgacggtgtggcaggtctctat
acgccggacggctactggcagcatgtggacaagcagattggtccggtgacgcaggcgctt
tatcaggacgatctctgggtgctggacggcgctgcaccgcagcagaagagtgagcagacc
gatctcgcggtgcgccagctctatgtgcaggactacatccgtcagtgggagcagttcctg
agcgatatccagctcaacagcagtgccgatctctcgcaacgtattaacaccgcgcgcttg
ctgtcgggcaaccactcgccgctgcgccagctggtcatcaacctcagtaacctgctgacg
ctgaaccgcgcgcagcccgatgagaaaacggcgcaggcggcaaagccgtcggataacagc
gccacccgcacccttgaagcgctgtttacctcgcctgaagcggctgcggcgcgtggacag
gcggcagcgcaggcgtcaccggagcaggcggttgccgtgcattttgcgcccgtgcttgag
ctggctcagccattacagcagggcagcaaggtgctggcggtggatgatttcctgcatcag
attgacgatctctatcgctacctcacggcggtgcaggatgccgccaacagcgggatgccg
ccaccggccagcgatgcaatcagtcgtttgcaggccagcgccggacgtctgcccggttcg
ctgcagaatatggtctccagcatggcggtcggggccagcagcgatgcacagcgccgcgac
atggataacgttcgtaaacgcatcaccatggaagtgggcagtttctgtcgtcaggcgatc
gccggacgttatccgctggtgcgttccgcgcgcagtgaggtgacacccgacgatctggcg
cggatgttcgcccccggcagcggcatgatggacagcttcttccgcgacaacctggccagc
aaagtcgacaccaccaacgcctcatggcgctttacgccgggtatcgacggcaaaacgctg
ccgggcggcgaagcgctgctgcgtcctttccagcaggcgcagtcaatccgcgatgcgttc
tttgctaacggtgcgaccacgccaggcttccgcgtcacgctgcgcaccgtaaaaatggac
aatgacattcttaacctgacgctggatgtggatggacagcaattgcgttacagccacggg
ccgcaggcagtacagatggtcagctggcccggtccgggcggcaccagccaggtgcgcatg
cagctgggcctgaccaacggcaccacctcaacgctggtcaccagtgggccctgggcactc
aatcgcttcttcgatcgcgcccgtgttaccgcggctggcggcctgacccgcgaagccacg
ttcagcgtggaggggcatcaggtcacgctgttgttcaccccagggagcattcgtaacccg
ttccagcttcccggctttagctgcccctga

DBGET integrated database retrieval system