KEGG   Pantoea vagans C9-1: Pvag_1028Help
Entry
Pvag_1028         CDS       T01326                                 

Definition
(GenBank) Putative type VI secretion system, core protein
  KO
K11901  type VI secretion system protein ImpB
Organism
pva  Pantoea vagans C9-1
Brite
KEGG Orthology (KO) [BR:pva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1028
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: ADO09221
UniProt: E1SAE6
Position
1081946..1082479
Genome map
AA seq 177 aa AA seqDB search
MATSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLVGKPLEPQPGIDD
RKFLEIDIDNFDERMKALKPRAAFQVDNTLNGEGKLNIDLTFDSMDDFSPDAVARNVEPL
SKLLEARTQLANLLTYMDGKNGAEELIGKVLQDPTLLQALTHLPKQDEATEGKEPQA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaagcaaatccagtgggcagaagttcattgcccgcaatcgcgcgcctcgcgtt
cagattgaatatgacgtggaaatttatggcgcggaacgcaaaatccagctgccgtttgtg
atgggcgtgctggcggatctggtgggtaaaccgctggagccgcagccgggcatcgacgac
cgcaaattccttgagatcgacatcgacaacttcgatgagcgcatgaaagcgctgaagcca
cgcgccgcgttccaggtagacaacaccctgaacggcgaaggcaagctcaacatcgatctc
actttcgacagcatggacgacttttcgccggatgccgtggcccgcaacgtcgagccgctg
agcaagctgctggaagcgcgtacccagctggcaaatctgctgacctatatggacggcaaa
aacggtgcggaagagctgattggtaaagtgctgcaggacccaacgctgctgcaggctctg
acccatctgcctaagcaggatgaggccactgaaggtaaggagccgcaggcatga

DBGET integrated database retrieval system