KEGG   Pantoea vagans C9-1: Pvag_1029Help
Entry
Pvag_1029         CDS       T01326                                 

Definition
(GenBank) Putative type VI secretion system, core protein
  KO
K11900  type VI secretion system protein ImpC
Organism
pva  Pantoea vagans C9-1
Brite
KEGG Orthology (KO) [BR:pva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1029
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB SH2_2
Motif
Other DBs
NCBI-ProteinID: ADO09222
UniProt: E1SAE7
Position
1082476..1083975
Genome map
AA seq 499 aa AA seqDB search
MTQTSQQPQSQGAASFSQDEFSALLNKEFRPKSDQARAAVESAVKTLAQQALENTVTVSS
DAYRTIQALIAEIDEKLSQQVNQIIHHPEFQSLESAWRGLSYLVNNTETDEMLKIRFMSI
SKQELGRTLKRYKGAGWDQSPLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGE
MARIGSAAHCPFITGTAPEVMQMESWQELANPRDLTKIFQNTEYAAWRSLRESEDARYLG
LVMPRFLARLPYGIRTNPVDSFDFEEQTDGSDHGNYTWSNAAYAMAANINRSFKEYGWCT
AIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSDF
AAFIGAQSLQKPTEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVNVEEQEDNPGYYAAKFFLRPHYQLEG
LTVSLRLVSKLPSLKNDNA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacttcacaacaaccccagtcgcagggcgcggcaagtttcagccaggatgag
ttcagcgcgctgctgaacaaagaattccggccgaaaagcgatcaggcacgtgccgcggtc
gagagcgcggtaaaaactctggcgcagcaggcgctggagaacaccgtcaccgtttccagc
gacgcctatcgcaccattcaggcgctgatcgcggagatcgacgaaaagctgtcgcagcag
gttaaccagattattcaccatccggagtttcagtcgctggagagcgcctggcgcggcctg
agctatctggttaacaacaccgaaacggatgagatgctgaaaatccgttttatgagcatc
tccaagcaggaactgggtcgtacgcttaagcgctataaaggtgctggctgggaccaaagc
ccgctgttcaagaagatctatgagcaggagtatggtcagttcggcggcgagccgtttggc
tgtctggtgggcgactattacttcgaccatagcccgcaggatgttgagctgctgggtgag
atggctcgcatcggttcggcggcacactgtccgtttatcaccggcaccgcgccggaagtg
atgcagatggaatcctggcaggagctggcaaatccgcgcgatctgaccaaaatcttccag
aacaccgaatatgctgcctggcgcagcctgcgtgagtcggaagatgcacgttatctgggc
ctggtgatgccgcgtttcctggcgcgtctgccatatggcattcgtaccaacccggtcgac
agcttcgattttgaagagcagaccgacggttccgatcacggcaactacacctggagcaat
gcggcgtatgcgatggccgccaacatcaaccgctcctttaaggagtatggctggtgtacc
gcaatccgcggcgtagaatcgggcggggcggttgagaacctgccgtgccacaccttcccg
agcgacgacggcggcgtggacatgaagtgtccgaccgaaatcgccatcagcgatcgccgc
gaagccgaactggcgaaaaacggctttatgccgctggtgcatcgcaaaaactctgacttc
gccgcctttattggcgcgcagtcactgcagaagccgacggaatatcacgacgccgatgcc
accgccaatgcccgtctggccgcgcgtctgccttatctgttcgcctgctgccgctttgcg
cattacctgaagtgcatcgtgcgtgacaagatcggctccttccgcgagcgcgatgagatg
gaacgctggctgaacgattgggtgatgaactacgtcgatggcgatccggctaactcctcg
caggagaccaagtctcgtaagccgctggccgctgccgaggtgaatgtggaagagcaggaa
gataatccgggctattacgccgcgaagttcttcctgcgtccgcactaccagctggaaggc
ctgaccgtttcgctgcgtctggtctctaagctgccgtcactgaagaatgataatgcttaa

DBGET integrated database retrieval system