KEGG   Pantoea vagans C9-1: Pvag_1031Help
Entry
Pvag_1031         CDS       T01326                                 

Gene name
hcp
Definition
(GenBank) Putative type VI secretion system, effector protein hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pva  Pantoea vagans C9-1
Pathway
pva03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pvag_1031 (hcp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1031 (hcp)
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1031 (hcp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ADO09224
UniProt: E1SAE9
Position
1084523..1085005
Genome map
AA seq 160 aa AA seqDB search
MAIDMFMKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNA
LIDKSTTALLKNCASGKHLTKVELSICKAGGSQVEYARITLEDVLVTAVNYNGSDNGDTL
GMTYSFQASKVKQQYWEQSSSGGKGAESSAGWDIKGNKEA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctattgatatgtttatgaaggttgacggagtcaccggcgagtcaaaagactcaaac
cacactggctggactgatattacctctttctcatggggtgcttctcagccaggcaacatg
tctgtgggcggcggcggcggtgcgggtaaagttaacttcaacgacctgcacgtgaatgca
ctgatcgacaaatccaccactgcgctgctgaagaactgcgcaagcggtaagcatctcact
aaagttgaactctctatctgtaaagcgggcggttctcaggttgagtatgcgcgcatcacc
ctggaagacgttctggtgaccgctgtgaattacaatggctccgacaacggcgataccctg
ggaatgacctactccttccaggcatccaaagtgaagcagcagtactgggagcagagttct
tccggcggcaaaggcgcagaaagcagcgccggctgggacattaaaggcaacaaagaagcg
taa

DBGET integrated database retrieval system