KEGG   Pantoea vagans C9-1: Pvag_1038Help
Entry
Pvag_1038         CDS       T01326                                 

Definition
(GenBank) Putative type VI secretion system-associated hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
pva  Pantoea vagans C9-1
Brite
KEGG Orthology (KO) [BR:pva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1038
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Pvag_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE TPR_19
Motif
Other DBs
NCBI-ProteinID: ADO09231
UniProt: E1SAF6
Position
1091400..1092227
Genome map
AA seq 275 aa AA seqDB search
MESLQHHLANATLSETLTDVTRQIQANPANADLRAAFVQLLCLAGNWTRAQTQLQSWLAL
SPQAQPTVNLLQQAIAGELQRDAVLRGEAQPVLPGSAWHWCDTLLAALQAETAGDVARGS
ALRADALELAAANPGTATGQDQPTAFSWLMDGDSRFGPVCEVINQGRYYWIPFAAIREMQ
FQAPASVTDLVWRHTRVQLVDGSEQVCQIPARYPLLAGADERFLRTSVTEWQPLGNDPDQ
FIGQGQKMWLSDSAEFSLLSLQQVAFDNVESADEP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaatccttacaacatcatcttgcgaacgccacgctcagcgagacgctgactgacgtt
acccgccagattcaggccaatccagcgaacgccgatctgcgcgccgcctttgtccagtta
ctctgcctggcgggcaactggacgcgtgcgcagacgcagctgcaatcctggctggcgtta
agcccgcaggcgcaaccaacggttaatctgttgcagcaggcgattgccggtgagctgcag
cgtgatgccgtgctgcgtggcgaggcacaacccgtgctgccgggcagcgcctggcactgg
tgcgacacactgctggccgcattacaggccgaaaccgcgggtgatgtcgcgcgcggcagc
gcactgcgtgccgacgcgctggagcttgctgccgccaatcccggcaccgcgaccgggcag
gatcagccgaccgccttcagctggctgatggatggcgacagccgtttcgggccggtgtgt
gaagtgatcaatcagggccgttattactggatcccgttcgccgccattcgtgagatgcag
ttccaggcacccgccagcgtcaccgatctggtgtggcgtcatactcgggtgcaactggtg
gatggcagcgaacaggtgtgtcagatcccggcgcgctatccgctgctggcgggtgcggac
gagcgttttctgcgcaccagcgtcaccgaatggcagccgctgggcaacgatccggaccag
tttatcggccagggacaaaaaatgtggctcagcgacagcgcggagttctcgctgctgagc
ctgcagcaggtcgcgttcgataacgttgagtccgccgatgagccatga

DBGET integrated database retrieval system