KEGG   Pantoea vagans C9-1: Pvag_1039Help
Entry
Pvag_1039         CDS       T01326                                 

Definition
(GenBank) Putative type VI secretion system, core protein
  KO
K11897  type VI secretion system protein ImpF
Organism
pva  Pantoea vagans C9-1
Brite
KEGG Orthology (KO) [BR:pva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1039
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ADO09232
UniProt: E1SAF7
Position
1092217..1092792
Genome map
AA seq 191 aa AA seqDB search
MSHDSGAHNDGYAQLHGGFRARKKRDALTARDKLQSSLLDRLTDNAPDKQQEPENSMLIS
HSTLRRHVLRDLQWLFNTINNEAQQDLDGFDQVQRSVWNFGVAPLAGQNVSDIEWQDMQR
KMTNAILHFEPRILPQGLQVRCVSDLGSLSLHNVLSIEIKGRLWCVPYPLAFLFRTQVDL
ESGHFELQDAG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagccatgattcaggcgcgcacaacgacggctatgcccagctgcatggcggctttcgt
gcgcgcaaaaagcgcgatgcgctgaccgcccgcgacaaactgcaatcctcgctgctggac
cgcctgaccgacaacgcgccggacaaacagcaggagccggagaacagcatgctgatcagc
cacagtacgctgcgccgccacgtgctgcgcgatctgcagtggctgtttaacaccatcaac
aacgaagcgcagcaggatctggacggtttcgatcaggtgcagcgctcggtctggaacttc
ggcgtagcgccgctggccggacagaacgtctccgatatcgaatggcaggatatgcagcgc
aaaatgaccaacgccattctgcacttcgagccgcgtattctgccgcagggtctgcaggtg
cgctgcgtcagcgatctcggctcgcttagtctgcacaacgtgctgtcgattgagatcaaa
gggcgcctctggtgcgtgccttatccgctggcgtttctgttccgcactcaggttgatctg
gagagcggccatttcgaacttcaggatgcagggtaa

DBGET integrated database retrieval system