KEGG   Pantoea vagans C9-1: Pvag_1044
Entry
Pvag_1044         CDS       T01326                                 

Gene name
vgrS
Definition
(GenBank) Putative type VI secretion system, effector protein vgrS
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pva  Pantoea vagans C9-1
Pathway
pva03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pvag_1044 (vgrS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pva02044]
    Pvag_1044 (vgrS)
Secretion system [BR:pva02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pvag_1044 (vgrS)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C bCoV_SUD_C
Other DBs
NCBI-ProteinID: ADO09237
UniProt: E1SAG2
Position
1099920..1102136
AA seq 738 aa
MFSRITAQLPADGLLFHTLTGTETLSRPFVLTAELLATDARIDRHALLGKPVTFSLPTDG
LMSALSPRYLNGKITRVAVRSQELSGTRYAVYQLTVEPDLWPMRRDRNLRIFQSQTVPQI
VQTLLKEYAVNVETRLAGNYRVWEYCVQYQESSLDFISRLMELEGIYYFFRHEADKHTLV
LCDAPDQHQAFPGYETIAYHVTQSGGVVTEEGISQWSLAESVTPGIYSTDDYDFRKPNAW
MLQARQNPASPVPGSVDVYDWPGHFVDHSHGESYARIRQEVWQAEHHSVSGSGTATGIAP
GFTFAIINAPHFSDNGEYLVTSATYDFAENSYASGDTGDSRHNISFTVLPSSVTYRTPPE
TPWPKTHGPQTAKVVGPKGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRSKDGTA
DTANALRFEDKAGEEHLWIQAQKNMDTHVKNDASHSVANNHSHYAGGNELYRVETNRVHG
VKGGEERLTGKGKLDAVVDTYVVGSGTKLRLECGESAIELNANGQINIVGKGFNIFVQGD
GHITTSGGKLNLNTDGAKPGTSAPGSSHKQNISQAVDNLFPPKQKGQAASAAPKAGAAPA
KGAAAPLKQNTNAGDPKKLDDSVVRSIMKSEGAGGEQGVYRKCMVSEKDLGLHIKISLPP
GNSMDRVVMKNSQWFQNI
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgttctcacgcattactgcacagctgccggcggacggcctgctgttccacacgctcacg
ggcaccgagacgctgtcccgtccgtttgtgctcactgccgaactgctggccaccgacgcg
cgcatcgaccgtcacgccctgctgggcaagccggtcaccttttcgctgccgaccgatggc
ctgatgagcgcgctgagtccgcgctacctcaacgggaaaatcacccgggtggcggtgcgc
agccaggagctgagcggcacccgctacgcggtctaccagctgacggtcgagccggacctg
tggccgatgcggcgcgaccgcaacctgcgcatcttccagagccagacggtgccgcagatt
gtgcagacgctgctgaaggagtacgcggtcaacgttgagacgcgcctggcgggtaactac
cgggtgtgggagtactgcgtgcagtatcaggagagcagcctggactttatcagccgcctg
atggagctggaggggatttactacttcttccgccacgaggcggacaaacatacgctggtg
ctgtgcgacgcgccggaccagcatcaggcgtttccgggctatgagaccatcgcctatcac
gtcacccagtccggcggcgtggtcacggaagagggcatcagtcagtggtcgctggcggag
agcgtgacgccgggcatctacagcaccgacgactacgacttccgcaagccgaacgcgtgg
atgctgcaggcgcggcagaacccggcgtcgccggtgccgggctcggtggacgtctacgac
tggccgggtcactttgtcgaccacagccacggcgagtcttacgcgcgcatccgtcaggag
gtgtggcaggccgagcaccacagcgtcagcgggtcgggcacggccaccggcatcgccccg
ggctttaccttcgccatcatcaacgcgccgcacttcagcgacaacggcgagtatctggtg
acctcggcgacctatgactttgccgagaactcctacgccagcggcgacaccggcgacagc
cgccacaacatcagcttcacggtgctgccgtcgtcggtgacgtaccgcacgccgccggag
acgccgtggccgaaaacgcacggcccgcagaccgcgaaggtggtcgggccgaaaggcgag
tcgatctggaccgaccgctacggccgggtgaaggtgaagtttcactgggaccggctggcg
aagggcgacgacaccagctcctgctgggtgcgcgtctccagcgcctgggctggtcagggg
ttcggcggggtgcagatcccgcgagtcaacgatgaagtggtcgtggactttattaacggc
gacccggatcgtccgctgatcatcggccgcgtgtataacgaggcgagtatgccgccgtgg
gcgctgccagcggcagcgacgcagatgggttttctgagccggtcgaaggatggcacggcg
gataccgcgaacgcgctgaggtttgaggataaggcgggtgaggaacacctgtggattcag
gcgcagaagaacatggatacgcatgttaaaaatgacgccagccattcagttgccaacaat
cacagccattacgcgggcggcaatgagctctaccgtgtcgaaactaaccgcgtccacgga
gtgaaagggggcgaagagcggctgaccggtaagggcaaactcgatgcggtagtcgatacc
tatgttgtagggtcgggcaccaaacttcgccttgaatgcggagagagtgctatcgaactc
aatgcgaatggtcagataaatatagtcggtaaaggattcaatattttcgtgcagggcgat
ggtcatatcaccacctctggcggcaaactgaacctgaacacggatggtgcgaaaccgggc
acgagtgctccgggatccagtcataaacagaacatcagtcaggccgtagataacctgttc
ccgccgaagcagaaagggcaggctgcatccgctgcaccaaaggctggggcggccccggcg
aaaggtgcggctgcgccgttaaaacaaaatacaaatgcgggtgatccgaagaaacttgat
gatagcgtcgtccggtcaattatgaagtcagaaggtgcgggtggtgaacagggggtgtac
cggaaatgtatggtttcagaaaaggatttgggcctgcatataaagatatcgctgccgcca
ggaaacagtatggacagggtagtgatgaagaattcgcagtggtttcaaaatatatga

DBGET integrated database retrieval system