KEGG   Pantoea vagans C9-1: Pvag_1245Help
Entry
Pvag_1245         CDS       T01326                                 

Gene name
ytfR
Definition
(GenBank) Putative ABC transport system, ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
pva  Pantoea vagans C9-1
Pathway
pva02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pva00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pvag_1245 (ytfR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pva02000]
    Pvag_1245 (ytfR)
Enzymes [BR:pva01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Pvag_1245 (ytfR)
Transporters [BR:pva02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Pvag_1245 (ytfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N RsgA_GTPase AAA_23 AAA_22 AAA_30 DUF2813 AAA_15 MMR_HSR1 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADO09435
UniProt: E1SCI6
Position
1307334..1308854
Genome map
AA seq 506 aa AA seqDB search
MMTQNEIPLLSISGVSKGFPGVKALSNVSFDIRKGEIMALLGENGAGKSTLIKVLTGVYS
RDAGTITLNGEPITPHNTAQAQEMGIGTVYQEVNMLPNMSVADNLYIGREPRRFGMIDRR
RMVRDADALMRNYGFSLDVTRPLGHYSVAMQQIVAICRAVDLSAQVLILDEPTASLDASE
VEMLFTLMAQLKAKGMSLIFVTHFLDQVYRITDRITVLRNGQFIATRDTATLTQIELIKL
MLGRELLETALQRQGSTLRSNQPVVSFEDYGRKGTIEPFNLAVRPGEVVGLAGLLGSGRT
ETAEVLFGIRRADRGTAKIKGKVQKITNPARASQLGMGFCPEDRKTDGIIGAASVRENII
LALQAQRGWLRPIKKREQQAIADRFIKSLGIRTPHAEQPVELLSGGNQQKVLLSRWLVTK
PQFLILDEPTRGIDVGAHAEIIRLIESLCADGLALLVISSELEELVGYADRVLIMRDLKQ
VAEIPLEQLSVASIVNAIADGGAKHA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgcaaaatgaaataccgctgttatccatcagcggcgtcagcaaagggtttccc
ggcgttaaagcgctgagcaatgtttcctttgatatccgcaaaggggagattatggcgctg
ctgggggaaaacggtgctggcaaatcgaccctgattaaggtgctgaccggcgtttacagc
cgtgatgccggcacgattaccctgaatggtgagccgatcaccccgcataacaccgcgcag
gcgcaggaaatgggcatcgggaccgtttatcaggaggtgaatatgctgccgaacatgtcg
gtggcagataacctctatattggtcgtgagccgcgtcgctttggcatgatcgaccgtcgc
cgcatggtgcgtgatgccgatgcgctgatgcggaactacgggttttccctcgacgtgaca
cgtccgctgggtcactactcggtggcgatgcagcagattgttgccatctgccgcgcggtg
gatctttcggcccaggtgctgatcctcgatgagccgacagccagcctggatgccagcgaa
gtcgaaatgctgtttaccctgatggcgcagctgaaagccaaagggatgagcctgattttt
gtgacccactttctcgaccaggtgtaccgcattactgaccggattaccgtgctgcgtaac
gggcagtttatcgccactcgcgataccgccacgctgacgcagattgaactgattaagctg
atgctgggtcgtgaactgctggagactgcattacagcgtcagggcagcacgctgcgcagt
aatcagccggtggtgtcgtttgaagattacggcaggaagggcactatcgaaccctttaac
ctggcagtgcgtcccggtgaagtcgtcggcctggccggtctgttgggttcgggccgcaca
gagaccgccgaagtgctgtttggtattcgtcgggccgatcgcgggaccgcgaagatcaaa
gggaaagtgcagaagattactaatccggcgagagcctcacagctcggcatggggttttgc
ccggaagatcgaaagacggatgggattatcggcgcggcctccgttcgcgaaaatattatt
ctggccttgcaggcgcagcgcggctggttaaggccgattaaaaagcgcgagcagcaggcg
attgccgatcgttttattaagagtctgggtattcgcacgccgcacgccgagcagccggta
gagctgttatcgggcggtaaccagcagaaggtgctgctgtcgcgctggctggtgactaaa
ccgcagtttttaatcctcgacgaaccgacgcgcggcattgatgtaggcgcacacgccgag
attatccgtttaattgaatccctgtgcgccgatggtctggcgctgctggtgatctcctct
gaactcgaagagctggtcggttatgccgatcgggtgctgatcatgcgcgatctgaagcag
gtggccgaaattccgctggagcagctttcggtagcgtcgatcgtcaatgctatcgcggac
ggaggggctaaacatgcctga

DBGET integrated database retrieval system