KEGG   Pantoea vagans C9-1: Pvag_1596Help
Entry
Pvag_1596         CDS       T01326                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA m1G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
pva  Pantoea vagans C9-1
Brite
KEGG Orthology (KO) [BR:pva00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pva03009]
    Pvag_1596 (rrmA)
Enzymes [BR:pva01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Pvag_1596 (rrmA)
Ribosome biogenesis [BR:pva03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Pvag_1596 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Ubie_methyltran MTS Methyltransf_12 Methyltransf_23 Methyltransf_32 PCMT Methyltransf_4 PrmA MetW Methyltransf_29 CheR Methyltransf_9 FtsJ
Motif
Other DBs
NCBI-ProteinID: ADO09784
UniProt: E1SFF3
Position
complement(1676264..1677073)
Genome map
AA seq 269 aa AA seqDB search
MSLICPLCHSPLTLTDRSWCCENRHQFDQAKEGYVNLLPVQHKRSREPGDSAEMMQARRE
FLEEGYYQPLREQVVSLLAPVLNQPECKILDIGCGEGYYTAALAEAADGDAEIYGLDVAR
MAIRLAAKRYPAVRFCVASSQRLPFADQSLDAIVRIYAPCNEAELARVLKPGGMVLTVTP
GPHHLQQFKALIYREVQLHVPEQKDYPGFRQVAQHALRYPMALTGAAATTLLQMTPFAWR
AREDVWQTLQQSEQFSCDADFTLTMWQRD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgatttgccctctttgtcactctccactgaccctcaccgaccgcagctggtgc
tgtgaaaaccgccatcagttcgatcaggcgaaagaagggtatgtcaatctgctgcccgtt
cagcataaacgatcgcgtgaaccgggtgacagtgcagagatgatgcaggcacgacgggaa
tttcttgaggaaggctattatcagccgctacgtgagcaggtagtcagcctgcttgcgccg
gtgctgaatcagccggagtgcaaaatcctggatatcggctgcggtgaagggtactacacc
gccgcactggcggaggcggcagacggagacgctgagatttatggcctggatgttgccaga
atggccatccggctggcggctaagcgctatcctgcagtacgtttctgcgtggcttccagt
cagcgcttaccctttgccgatcagtccctggatgcgattgtacgcatctacgcaccctgc
aatgaagcagaactggctcgcgtgctgaagccgggtggcatggtgctgacggtcacgcca
ggcccgcatcatctgcagcagttcaaagcgctgatttaccgcgaagtgcagctacatgtg
ccggaacagaaagattatcctggcttccggcaggtagcgcagcatgccctgcgttatccg
atggcattaaccggcgcagccgcgacgacactgctgcagatgacgccctttgcctggcgg
gcgcgtgaagacgtctggcaaacgctgcagcagagtgagcagttcagctgcgatgctgat
tttaccctgacaatgtggcagcgcgactag

DBGET integrated database retrieval system