KEGG   Pantoea vagans C9-1: Pvag_2032Help
Entry
Pvag_2032         CDS       T01326                                 

Gene name
adhc1
Definition
(GenBank) alcohol dehydrogenase class III
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00010  Glycolysis / Gluconeogenesis
pva00071  Fatty acid degradation
pva00350  Tyrosine metabolism
pva00625  Chloroalkane and chloroalkene degradation
pva00626  Naphthalene degradation
pva00680  Methane metabolism
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
pva01130  Biosynthesis of antibiotics
pva01200  Carbon metabolism
pva01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_2032 (adhc1)
  09102 Energy metabolism
   00680 Methane metabolism
    Pvag_2032 (adhc1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pvag_2032 (adhc1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Pvag_2032 (adhc1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pvag_2032 (adhc1)
   00626 Naphthalene degradation
    Pvag_2032 (adhc1)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pvag_2032 (adhc1)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     Pvag_2032 (adhc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Met_10
Motif
Other DBs
NCBI-ProteinID: ADO10214
UniProt: E1SJ76
Position
2145675..2146799
Genome map
AA seq 374 aa AA seqDB search
MNMIKTRAAVAWAAGEPLKIEEVDLMPPQKGEVLVRIVATGVCHTDAYTLSGTDPEGVFP
TILGHEGGGIVEAVGEGVTSVEVGDHVIPLYTPECGKCKYCLSGKTNLCQAIRTTQGKGL
MPDGTTRFFKDGKPIFHYMGTSTFSEYTVIPEISLAKISKEAPLEEVCLLGCGVTTGMGA
VMNTAKVKEGDTVAIFGLGGIGLSAVIGAKMAKAGRIIAIDLNTSKFDLARKLGATDLIN
PKDYDKPIQDVIVELTDGGVDFSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGEEIS
TRPFQLVTGRVWRGSAFGGVKGRSQLPGIVQDYLDGKFALNDFITHTMPLEEINDAFDLM
HEGKSIRSVVHFNK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatcaaaacccgtgccgctgttgcctgggccgctggcgaaccgctgaaaatc
gaagaagtggatttgatgccaccgcaaaaaggcgaagtgctggtgcgcattgtcgcaacc
ggtgtctgtcataccgacgcctataccctctccggcactgacccggaaggcgttttcccg
acgattctcggccatgaaggcggcggcattgtggaagccgtgggcgaaggcgtgaccagc
gtagaagtgggtgaccatgtcattccgctttacacgccagagtgtggcaaatgtaaatat
tgtctctcgggcaaaactaacctctgtcaggcgatccgaaccacccagggtaaaggtctg
atgccggacggcaccacccgtttctttaaagatggcaaaccgattttccactatatgggc
acctcgaccttctctgaatacaccgtcatcccggagatctcactggcgaaaatcagtaaa
gaagcgccgctggaagaagtttgcctgctgggctgtggcgtcaccaccggcatgggcgcg
gtaatgaacaccgccaaagtgaaagaaggcgacaccgtggcaatcttcggtctcggcggc
attggtctttctgcggtcatcggcgccaaaatggcgaaagccggacgcatcattgcaatc
gacctcaacaccagcaaattcgatctggcgcgcaaactgggtgccaccgatctgattaac
ccgaaagattacgataagccgattcaggatgtgattgtcgagctgaccgacggcggcgtg
gacttctcatttgaatgtatcggtaacgtcaacgtaatgcgttccgcgctggagtgctgc
cacaaaggctggggcgagtctgtgattatcggcgtcgccggtgccggtgaagagatctct
acccgtccgttccagctggtaaccggtcgcgtctggcgcggttccgcttttggtggcgtg
aaaggccgttcacagctgcctggcattgtgcaggattaccttgatggtaagtttgccctg
aacgacttcatcacccacaccatgccgctggaagagatcaacgacgcctttgatttgatg
cacgaaggaaaatcgattcgctcggtcgtgcactttaacaaataa

DBGET integrated database retrieval system