KEGG   Pantoea vagans C9-1: Pvag_2082Help
Entry
Pvag_2082         CDS       T01326                                 

Gene name
yojN
Definition
(GenBank) putative two-component system sensor kinase
  KO
K07676  two-component system, NarL family, sensor histidine kinase RcsD [EC:2.7.13.3]
Organism
pva  Pantoea vagans C9-1
Pathway
pva02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pva00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pvag_2082 (yojN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pva01001]
    Pvag_2082 (yojN)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pva02022]
    Pvag_2082 (yojN)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Pvag_2082 (yojN)
Protein kinases [BR:pva01001]
 Histidine kinases
  NarL family
   Pvag_2082 (yojN)
Two-component system [BR:pva02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   Pvag_2082 (yojN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsD_ABL HATPase_c Hpt HisKA
Motif
Other DBs
NCBI-ProteinID: ADO10262
UniProt: E1SJT0
Position
2214718..2217375
Genome map
AA seq 885 aa AA seqDB search
MLYKFPLTSGNVTRFFVVFNLVLLLALGFMVHNSVNAWLTGKRYAMDDLARDVQKRIDAY
RFATWQIYENLSTSAAGATPGSNLQETRLRPDVYYLEKTRRKTEALIFGSHDSSTLDMTM
RMSNYLDTLWGAENPTWSMYFLNGQDNSLIMISTLPLKDMATRYKESAISAMVDSRRAEM
LQQANALDERESFSPLRHLAFQNDHYFTLRTTFNQPGHLATVVAFDLPVNDIVPQNMPLE
NFQLRQDSSMPATTADQQEVENTRITLVNPNIEITATLPSTSLQLVYQVPITRLIIDSLH
NLLWPLLINLLLFLLSLAGIVLLRQQSLRPSENQSAELDSLRVLNEEIVASLPVGLLVYD
FASNRTLLSNKIAEHLLPHLNLQKIINMSDQHQGVLQATINNEVYEIRHARSVLSPHTQL
FMMRDQDRELLVNKKLQKAQQVLDRNHQMRQQLLHNLGHALNQPLEKMVTQLVQLSQRDA
DETVLDLLDESQGLARLVDDIVLLNRLEAHDWSPDATVFNLQELLDEIALESLPLMRRKG
LSLVVNNHLANDETRFGDRRALRKVLTTLMHYALTTTRWGKITLEVKAADKQADRVIIEL
VDTGAGLTVDELANVDFPFLGDTSQDRYGQASGMAFFLCKQLCKQMGGSLDIVAKADIGT
RYNMQLPLVLEQKHEEEEEKILDGVTALVEITVEDVHKIVCRHLENWGARCLTPDERISG
QDHDVLVTDDPSKLSGWALLLAEDELGHHALNDQQYRVNFNLSNAMLDALLALIEKQLSH
DVMDNDMEDDTATPLMSGGYFQLFTETVPVDVKRLYTESAEKDYASLAQTAHRLKGVFAM
LNLTPGKQLCEELEHHIKACDDSNITNTTSDIDAYVNQLLQQGNQ
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgttgtataagtttccactgacctccggcaatgtcacccgcttttttgtggttttcaat
ctggtgctgctgctggcgctgggctttatggtgcataactcggtcaatgcctggctgacc
ggcaaacgctatgccatggacgatctggcgcgtgacgtgcagaagcgcatcgacgcctac
cgctttgccacctggcagatctatgaaaatctctccaccagtgcagcaggcgccacaccc
ggcagcaatctgcaggagacgcggctgcgtcctgacgtctattacctggaaaaaacccgc
cgtaaaaccgaagcgctgattttcggctcacacgacagcagcacgctggatatgaccatg
cggatgtcgaactatctcgacacgctgtggggcgcagaaaatcccacctggtcgatgtat
tttttaaatggtcaggacaacagcctgattatgatctcgaccctgccgctgaaagatatg
gcgacgcgctataaagagagcgctatcagcgcaatggtggatagccgccgcgcggagatg
ctgcaacaggctaatgcgctggatgaacgcgagagcttctcgccgctgcgccacctcgcc
ttccagaacgaccactatttcacgctgcgcaccacttttaatcagccgggccatctggcc
acggtggtcgcctttgatctgccggttaacgatattgttccgcagaacatgccgctggaa
aacttccagctgcgtcaggacagctcaatgcctgccacgacagccgatcagcaggaggtg
gaaaacacccgcatcacgctggttaatcccaacattgaaattacggccaccctgcccagc
acgtcgctgcagctggtctatcaggtgccgattacccgcctgattatcgacagcctgcac
aacctgctctggccgctgctcatcaacctgctgctattcctgctgtcgctggcgggtatc
gtgctgctgcgccagcaatcgctgcgtcccagcgagaatcagagcgctgaactcgactcg
ctacgggtactgaatgaggagattgtcgccagcctgccggtcggcctgctggtgtatgac
tttgccagcaaccgcaccctgctgagcaataagattgctgaacatcttttgcctcacctc
aatctgcagaagattattaatatgtccgaccagcatcagggggtgctgcaggccactatc
aataacgaagtgtatgaaattcgccacgcccgcagcgtgctgtcgccacatacccagctg
tttatgatgcgtgaccaggatcgtgagctgctggtgaacaagaaactgcagaaagcacag
caggtgctggaccgcaaccatcagatgcgtcagcagctgctgcacaatctgggacatgcg
ctgaatcagccactggagaagatggtgacgcagctggtgcagctcagccagcgtgacgcc
gatgagactgtgctggacctgctcgatgagagccaggggctggcgcgactggtggatgat
atcgtgctgctgaaccggcttgaggcgcatgactggtcaccggatgccaccgtctttaac
ctgcaggagctgctggacgaaatcgcactggaaagcctgccgctgatgcgtcgcaaaggg
ctgtcgctggtggtgaataatcatctggcgaatgacgagacgcgctttggcgaccgtcgc
gccctgcgcaaagtgctgaccacgctgatgcactatgctctgaccaccacccgctgggga
aaaatcaccctggaagttaaggctgcggacaaacaggccgatagagtgatcatcgaactg
gtggacaccggtgcgggcctgacggtggatgagctggcgaatgtcgacttcccgttcctg
ggcgataccagtcaggatcgctacggacaggcttccggcatggcgttcttcctgtgtaag
cagctctgcaagcagatgggtggcagcctcgatatcgtggcaaaagcggatatcggcacg
cgctataacatgcagctgccgctggtgctggagcagaagcacgaagaagaagaggaaaag
attctggatggtgtgaccgcgctggtggagatcaccgtggaggacgtgcataaaatcgtc
tgccgtcatctggagaactggggcgcacggtgtctgacacccgatgagcgcatttccggt
caggatcacgatgtgctggtgaccgacgatccctcaaagcttagcggctgggcactgctg
ctggcggaagatgaactgggtcatcatgcactgaacgaccagcagtatcgggtcaatttc
aatctcagtaatgcgatgctggatgccttactggccctgattgagaagcaactgtcgcat
gatgtgatggataatgacatggaagacgacacggccacgccattgatgagcggcggctat
ttccagctgtttacggagacagtaccggttgatgtgaagagactgtatactgagtcggcg
gaaaaggactacgcctcgcttgctcagacagcgcatcgcctaaagggcgtgtttgccatg
ctcaatctgactcccggcaaacagctttgtgaagagttagaacaccacattaaagcgtgt
gacgattcaaacattacaaataccaccagtgatattgacgcttacgtcaatcaactgctg
cagcaaggtaaccaataa

DBGET integrated database retrieval system