KEGG   Pantoea vagans C9-1: Pvag_2472Help
Entry
Pvag_2472         CDS       T01326                                 

Gene name
yqcB
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pva  Pantoea vagans C9-1
Brite
KEGG Orthology (KO) [BR:pva00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pva03016]
    Pvag_2472 (yqcB)
Enzymes [BR:pva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Pvag_2472 (yqcB)
Transfer RNA biogenesis [BR:pva03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Pvag_2472 (yqcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ADO10636
UniProt: E1SCS4
Position
complement(2641856..2642635)
Genome map
AA seq 259 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRHETVFVMQTVRDQIGQHVFTAHRLDKPTSGV
LLMGLSSEVGRLLSLQFEQHQMQKTYHAVVRGWLESSGTLDYPLVEELDKIADRHATEAR
TAQPAVTDYQSLATVEMPVGIGRYPTSRYSLVEMAPKTGRKHQLRRHMSHLRHPIIGDSA
HGDLRQNRGAAEHFGANRLMLHASSLALTHPVTGEPLLIRAGLDGVWQNLMNQFGWQDRI
PEVPRVEFNAAPGQDNVSE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatactctatcaggatgagtggctggttgccgtcaacaagcccagcggctgg
ctggttcaccgcagctggctggatcgccatgaaaccgtgtttgtgatgcagaccgttcgc
gatcagattggacagcatgtgtttaccgcacatcgtctggacaaacccacctctggcgta
ctgctgatggggctttcaagcgaagtcggtcgtctgctttccctgcagttcgaacagcat
cagatgcagaaaacctatcatgccgtggtacgcggctggctggagagcagcggaacgctc
gactatccgctggtggaagagctggataaaattgctgacaggcacgccactgaagcgcgc
accgcacagcccgccgtcaccgattatcagtcactggcaacggtcgagatgccggtcggc
attggccgctatcccacttcgcgttacagcctggttgaaatggcccctaaaaccggccgc
aaacatcaactgcgtcgtcatatgtcgcacctgcgtcatccgattattggcgattcggcg
cacggcgatctgcgccagaaccggggtgccgctgaacactttggcgctaaccggctgatg
ctgcacgccagcagcctggcactcacccatccggtgaccggtgaacctttactgatccgc
gccgggctggatggcgtctggcagaacctgatgaaccagtttggctggcaggatcgcatt
cctgaggtgccgcgggttgagtttaacgcagcgccaggacaggataacgtttcagaataa

DBGET integrated database retrieval system