KEGG   Pantoea vagans C9-1: Pvag_2492Help
Entry
Pvag_2492         CDS       T01326                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pva  Pantoea vagans C9-1
Pathway
pva03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pva00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pvag_2492 (recD)
Enzymes [BR:pva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pvag_2492 (recD)
DNA repair and recombination proteins [BR:pva03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pvag_2492 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 AAA_22 DUF2075 UvrD-helicase UvrD_C AAA_16 AAA_28 PhoH T2SSE CbiA PE AAA_24 AAA_29 TrwB_AAD_bind MukB FtsK_SpoIIIE SRP54 AAA_33 AAA NTPase_1 DUF87
Motif
Other DBs
NCBI-ProteinID: ADO10653
UniProt: E1SCU1
Position
complement(2657755..2659596)
Genome map
AA seq 613 aa AA seqDB search
MSDMLSLLLQAVEKRLLRPLDIQFARLMATESQPALLLAAACVSAEAGEGHVCLPLSNLC
EDSLFAGRQPALAQAIWQAAGKPDDWPSLLADWSAVSNGSRVTPLVLSNQRLYLHRLWHS
EGRVADFFAAQDVKTAFDMRAAGDVLNSLFGDQPENWQKIAAAVALTRKTAVISGGPGTG
KTTTVAKLLAALIRLNPGALRIQLAAPTGKAAARLTESLGRALQDLAVSDEERRRFPAEA
TTLHRLLGAQPDTQRLRYHAGNPLHLDVLVVDEASMVDLSMMAKLIAALPAHARVVFLGD
RDQLASVEAGAVLGDICRCTESGYSLARAEQLALLTGCTLQGSDDGQAPVVRDSICLLQK
SYRFDASSGIGQLAKAINLGDAEQVRAVFAAAHDDVSYQTLNSAQAYQVMLDEVAQGYQP
FLQLIRQQADPAEVIAAFGRYQLLCALRDGPFGVQGLNQRIEQRLMQLQRIRRPGIGSRW
YAGRPVMITRNDSALGLFNGDIGITLRDEEGNLKVFFPLPDGSIKAIQPSRLPSHETAWV
MTVHKSQGSEFDHTALVMPTQFLPVLTRELVYTAITRARKQLTIYSEPGVFQRAVQLQTQ
RRSGLVERLGETG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatgctgagtctgctgctgcaggcggttgagaagcgtctcctgcggccgctg
gatattcagtttgcccgtctgatggcgacagaatcacaacctgcgctgctgctggcggcc
gcctgcgtcagcgcggaggccggtgaaggtcacgtctgtctgccgctgagcaacctctgt
gaagacagtctgtttgccgggcgtcagcctgcgctggcccaggccatctggcaggcagcg
ggtaagccggatgactggccatcactcctggcagactggtcggcggtcagtaatggcagt
cgggtgacgccgctggtgctgagcaaccaacgtttgtatctgcatcggctatggcacagt
gaaggccgggtcgccgacttttttgctgcgcaggacgtgaaaaccgcgtttgatatgcgt
gccgcgggtgacgtgctgaacagtctgtttggtgaccagccggagaactggcagaaaatt
gctgcggccgtggcgctgacccgcaagacggcggtcatttccggcgggccgggcaccggt
aaaaccaccaccgtggcgaaactcctcgctgccctgattcgcctgaatcccggcgcgctg
cggattcagctggcagcaccgacaggcaaagccgctgcgcgactgaccgagtcgctgggc
cgggcgctgcaggatctggcggtcagcgacgaagagcggcggcgttttcccgccgaagcc
accacgctgcatcgtctgctgggcgcacagcccgatacccagcggttacgctaccatgcc
ggtaacccactgcatcttgatgtgctggtagtggatgaagcgtcgatggtcgatctctcg
atgatggcaaaactgatcgccgcgctgcctgcccatgcccgcgtggtgtttctgggcgac
cgcgatcagctcgcctccgttgaagccggtgcggtgctgggcgatatctgccgctgcacg
gaaagcggctacagcctggcgcgggccgaacagctcgccctgctgaccggctgtacgctg
cagggcagtgacgatggacaggcaccggtcgtgcgcgacagcatctgcctgctgcaaaaa
agttatcgttttgacgcttcatccggcatcggccagctggcaaaagcgatcaaccttggt
gatgcagagcaggtcagggcggtatttgctgcggcccatgacgatgtcagttaccagacg
ctgaacagcgcgcaagcgtatcaggtgatgctggatgaggtcgcacagggctatcagccc
ttcctgcagcttatccgacagcaggcggatcctgctgaggtgattgccgcctttggccgt
tatcagctgctgtgtgcgttacgtgacgggccatttggcgtgcagggcctgaaccagcgt
attgagcagcgactgatgcagctgcagcgcatccggcgtcctggtatcggcagtcgctgg
tatgccgggcgtccggtgatgatcacccgaaatgacagtgcgctcggcctgtttaacggt
gatatcggcattacgctgcgggatgaagagggtaacctgaaggtctttttcccgctgccg
gatgggtcaatcaaggcgatccagccgagccggttaccttcacatgaaacggcctgggtg
atgacggtgcataaatcgcaggggtcggagttcgaccacactgcgctggtgatgccgacg
cagtttctgccggtgctgacccgagaactggtctataccgcgattacccgcgcacgtaag
caactgaccatttacagcgaaccgggcgtatttcagcgcgccgtgcagctgcagacgcag
cgacgcagcggtctggtggaacgactgggtgaaaccggctga

DBGET integrated database retrieval system