KEGG   Pantoea vagans C9-1: Pvag_3159Help
Entry
Pvag_3159         CDS       T01326                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00010  Glycolysis / Gluconeogenesis
pva00051  Fructose and mannose metabolism
pva00562  Inositol phosphate metabolism
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
pva01130  Biosynthesis of antibiotics
pva01200  Carbon metabolism
pva01230  Biosynthesis of amino acids
Module
pva_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pva_M00002  Glycolysis, core module involving three-carbon compounds
pva_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_3159 (tpiA)
   00051 Fructose and mannose metabolism
    Pvag_3159 (tpiA)
   00562 Inositol phosphate metabolism
    Pvag_3159 (tpiA)
Enzymes [BR:pva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pvag_3159 (tpiA)
Exosome [BR:pva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pvag_3159 (tpiA)
  Exosomal proteins of bladder cancer cells
   Pvag_3159 (tpiA)
  Exosomal proteins of melanoma cells
   Pvag_3159 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADO11301
UniProt: E1SIP9
Position
3336878..3337645
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKQITAELIAGLRKELSGVEGCGVAIAPPALYLEQAKHAISGSHIA
LGAQNVDVNLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKYAVLKSVG
LVPVLCIGETEAENEAGKTEEVCARQLDAVLETQGAEAFKDAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAIAEQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaagttgaatggcagcaagcagatcacagct
gaactgatcgccggtctgcgcaaggaactctctggcgttgaaggttgtggcgtcgccatt
gcaccgccagcgctctatctcgagcaggcaaaacacgccatctccggtagccacatcgca
ctgggtgcgcagaacgtagacgttaacctgtctggcgcgtttaccggtgaagtttccgct
gaaatgctgaaagatatcggcgcgaaatatatcattatcggtcactcagaacgccgcact
taccacaaagagagcgacgagttcatcgcgaagaaatacgcggtactgaagtcagtgggc
ctggtcccggtgctgtgcattggtgaaaccgaagcagaaaacgaagcgggtaaaaccgaa
gaagtctgcgcgcgtcagctggatgccgttctggaaactcagggcgctgaagcgttcaaa
gatgcggttatcgcgtatgagcccgtctgggccatcggtaccggcaaatctgcgacccct
gctcaggcacaggccgtccacaaattcatccgtgatcatatcgcgaagaaagatgcggct
atcgcagaacaggtcatcattcagtacggcggctcggttaacgataagaatgctgctgag
ctgttcacccagcctgacatcgatggcgcgctggttggcggtgcgtcactgaaagcagat
gctttcgcggtaatcgttaaagctgcggcggctgcaaaaagcgcttaa

DBGET integrated database retrieval system