KEGG   Pantoea vagans C9-1: Pvag_3162Help
Entry
Pvag_3162         CDS       T01326                                 

Gene name
pfka3
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00010  Glycolysis / Gluconeogenesis
pva00030  Pentose phosphate pathway
pva00051  Fructose and mannose metabolism
pva00052  Galactose metabolism
pva00680  Methane metabolism
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
pva01130  Biosynthesis of antibiotics
pva01200  Carbon metabolism
pva01230  Biosynthesis of amino acids
pva03018  RNA degradation
Module
pva_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_3162 (pfka3)
   00030 Pentose phosphate pathway
    Pvag_3162 (pfka3)
   00051 Fructose and mannose metabolism
    Pvag_3162 (pfka3)
   00052 Galactose metabolism
    Pvag_3162 (pfka3)
  Energy metabolism
   00680 Methane metabolism
    Pvag_3162 (pfka3)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pvag_3162 (pfka3)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pvag_3162 (pfka3)
Protein phosphatases and associated proteins [BR:pva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pvag_3162 (pfka3)
Messenger RNA biogenesis [BR:pva03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pvag_3162 (pfka3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADO11304
UniProt: E1SIQ2
Position
complement(3339742..3340704)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALSEGLEVFGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRNEDVRQVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEFPYTREELVAEIKAGIAKGKKHAIVAITEHICDIDDLARFIETETK
RETRSTVLGHIQRGGAPCAYDRILASRMGAYSIELLMQGYGGRCVGIQNEKMVHHDIVDA
IENMKRPFKRDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattggtgtattaaccagcggcggtgacgccccaggcatgaacgcagct
attcgtggagtggttcgttccgcgctgagtgaaggactggaagtttttgggatctatgac
ggttatctgggattgtacgaagatcgcatgatcaatcttgatcgctacagcgtctccgac
atgattaaccgtggcggcacattcctgggctcagcgcgtttccctgagttccgtaatgaa
gatgtgcgccaggttgccattgagaacatgaaaaagcgcggcatcgatgcgctggttgta
attggtggcgatggttcttacatgggtgctaagcgcctgactgaaatgggcttcccctgc
atcggtctgccaggcaccatcgataatgacgtggccggaacggattacaccatcggttat
ttcactgcgctggaaaccgtggttgaagcgattgaccgcctgcgtgatacctcttcttcg
catcagcgtatttcgattgttgaagtgatgggccgctattgtggtgatctgaccctggcg
gcggcgattgccggtggctgtgagttcatcgtcctgccagagttcccgtatacccgcgaa
gagctggttgcggaaatcaaagcgggcatcgccaaaggtaaaaagcacgctatcgtggcg
attaccgagcacatctgcgatatcgacgatctggcgcgtttcattgaaacagagaccaaa
cgtgaaacccgttcgaccgttctgggccatattcagcgtggtggtgcaccttgtgcttat
gaccgtatcctggcgtcacgcatgggcgcttactccattgaactgctgatgcagggttac
ggcggccgttgcgtcggtattcagaacgagaagatggtacatcacgatatcgtcgacgcc
attgaaaacatgaagcgtccattcaagcgcgactggctggacacagcgaaaaaactctat
taa

DBGET integrated database retrieval system